Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5TB33

Protein Details
Accession A0A1Q5TB33   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-58SMTNPRTTRNKQERRRSPTTSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MVNTSVSSDYSVEEITQVGRKGRSHGHKYDGADFDESMTNPRTTRNKQERRRSPTTSNKARASSGSASKRRTASKNVHSHQPQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.13
4 0.14
5 0.15
6 0.18
7 0.19
8 0.23
9 0.31
10 0.39
11 0.42
12 0.45
13 0.48
14 0.49
15 0.51
16 0.54
17 0.48
18 0.4
19 0.33
20 0.29
21 0.25
22 0.21
23 0.18
24 0.14
25 0.13
26 0.12
27 0.11
28 0.16
29 0.21
30 0.23
31 0.34
32 0.43
33 0.52
34 0.61
35 0.72
36 0.78
37 0.8
38 0.84
39 0.8
40 0.78
41 0.79
42 0.8
43 0.79
44 0.76
45 0.72
46 0.66
47 0.61
48 0.53
49 0.47
50 0.42
51 0.41
52 0.43
53 0.45
54 0.46
55 0.5
56 0.53
57 0.55
58 0.55
59 0.55
60 0.56
61 0.6
62 0.67
63 0.66
64 0.72