Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q5T2Y3

Protein Details
Accession A0A1Q5T2Y3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-67SLFVYRKWMARKAKKQSFQTAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, E.R. 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012589  Pmp1/Pmp2  
Gene Ontology GO:0016020  C:membrane  
GO:0030234  F:enzyme regulator activity  
GO:0050790  P:regulation of catalytic activity  
Pfam View protein in Pfam  
PF08114  PMP1_2  
Amino Acid Sequences MPAITVTNQPQGTDMTTITKRGNWASREPGVILVFAIVFLVGLGIVSLFVYRKWMARKAKKQSFQTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.2
5 0.2
6 0.2
7 0.2
8 0.24
9 0.29
10 0.27
11 0.3
12 0.33
13 0.34
14 0.34
15 0.32
16 0.29
17 0.23
18 0.2
19 0.15
20 0.09
21 0.07
22 0.06
23 0.05
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.03
37 0.07
38 0.08
39 0.13
40 0.18
41 0.27
42 0.38
43 0.48
44 0.59
45 0.67
46 0.76
47 0.81