Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5T6A7

Protein Details
Accession A0A1Q5T6A7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-75WYKFRDDPRHHARQRQRKFCEBasic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 7, extr 4, cyto_mito 4, E.R. 3, golg 3
Family & Domain DBs
Amino Acid Sequences MQPGVNGFCSAHHAGLIKSVILKFGMMGMFVISHVQLANEPSTNQESVYDLMYGWYKFRDDPRHHARQRQRKFCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.19
4 0.14
5 0.14
6 0.14
7 0.13
8 0.12
9 0.12
10 0.08
11 0.09
12 0.09
13 0.07
14 0.07
15 0.06
16 0.05
17 0.06
18 0.06
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.06
26 0.06
27 0.06
28 0.08
29 0.1
30 0.11
31 0.1
32 0.1
33 0.1
34 0.11
35 0.11
36 0.1
37 0.08
38 0.08
39 0.11
40 0.1
41 0.1
42 0.1
43 0.11
44 0.13
45 0.21
46 0.31
47 0.35
48 0.45
49 0.53
50 0.63
51 0.67
52 0.74
53 0.77
54 0.78
55 0.83