Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5TEV1

Protein Details
Accession A0A1Q5TEV1   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
61-89TTRTASRSSVRRPRPKRKGAWKKVCSFWTHydrophilic
NLS Segment(s)
PositionSequence
70-83VRRPRPKRKGAWKK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPESSELPVDPEPPANAFVRNHRSPTPPEALELQEIQTREDDEQLNYSSASASSGEEYRVTTRTASRSSVRRPRPKRKGAWKKVCSFWTHNVTLTVPQKSNRDHLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.2
4 0.2
5 0.28
6 0.34
7 0.36
8 0.38
9 0.39
10 0.43
11 0.43
12 0.48
13 0.46
14 0.37
15 0.36
16 0.35
17 0.32
18 0.3
19 0.26
20 0.21
21 0.17
22 0.17
23 0.16
24 0.14
25 0.13
26 0.12
27 0.14
28 0.13
29 0.11
30 0.13
31 0.14
32 0.13
33 0.12
34 0.12
35 0.09
36 0.08
37 0.08
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.12
50 0.16
51 0.18
52 0.2
53 0.23
54 0.29
55 0.37
56 0.46
57 0.54
58 0.61
59 0.69
60 0.77
61 0.83
62 0.86
63 0.87
64 0.89
65 0.91
66 0.91
67 0.93
68 0.9
69 0.86
70 0.84
71 0.78
72 0.73
73 0.67
74 0.64
75 0.61
76 0.54
77 0.49
78 0.43
79 0.4
80 0.41
81 0.41
82 0.38
83 0.34
84 0.36
85 0.41
86 0.42
87 0.47