Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8XZW3

Protein Details
Accession G8XZW3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
135-156IAEKRPGYKKQIAKRNNKKVWWHydrophilic
NLS Segment(s)
PositionSequence
138-153KRPGYKKQIAKRNNKK
Subcellular Location(s) nucl 16.5, mito_nucl 12.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSLSAKEAFKKLPEKLHNFFIKYPPRPFAEYSSKPSTISDPNMNPFLPNKNEETGKWHEPRFSLRRSADLFKMAYKFGIHDLLPPIPHKRFYAEKYYNKNWMRGVLFQKKHKWERELPEKLKEREEAIAKMDEIIAEKRPGYKKQIAKRNNKKVWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.65
4 0.64
5 0.61
6 0.59
7 0.59
8 0.59
9 0.58
10 0.58
11 0.54
12 0.51
13 0.51
14 0.51
15 0.49
16 0.49
17 0.48
18 0.5
19 0.52
20 0.49
21 0.46
22 0.44
23 0.41
24 0.36
25 0.35
26 0.35
27 0.31
28 0.34
29 0.35
30 0.34
31 0.31
32 0.28
33 0.29
34 0.25
35 0.24
36 0.24
37 0.25
38 0.26
39 0.26
40 0.3
41 0.3
42 0.34
43 0.36
44 0.34
45 0.33
46 0.33
47 0.41
48 0.4
49 0.37
50 0.38
51 0.34
52 0.38
53 0.4
54 0.41
55 0.35
56 0.32
57 0.3
58 0.24
59 0.25
60 0.2
61 0.17
62 0.13
63 0.12
64 0.11
65 0.12
66 0.1
67 0.1
68 0.12
69 0.12
70 0.13
71 0.14
72 0.17
73 0.16
74 0.18
75 0.17
76 0.19
77 0.24
78 0.26
79 0.35
80 0.4
81 0.47
82 0.53
83 0.56
84 0.62
85 0.58
86 0.58
87 0.49
88 0.45
89 0.4
90 0.38
91 0.43
92 0.43
93 0.47
94 0.51
95 0.58
96 0.62
97 0.67
98 0.68
99 0.66
100 0.64
101 0.68
102 0.73
103 0.75
104 0.7
105 0.72
106 0.73
107 0.69
108 0.65
109 0.56
110 0.48
111 0.43
112 0.43
113 0.35
114 0.3
115 0.3
116 0.26
117 0.24
118 0.22
119 0.17
120 0.15
121 0.15
122 0.15
123 0.15
124 0.16
125 0.23
126 0.28
127 0.33
128 0.39
129 0.46
130 0.52
131 0.6
132 0.7
133 0.72
134 0.78
135 0.85
136 0.88