Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5TD78

Protein Details
Accession A0A1Q5TD78    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
226-245RSPTRQERERHNRRRTAKSABasic
277-300IEESPSIRLQRRRRDKPREEWIAMHydrophilic
NLS Segment(s)
PositionSequence
57-115QPAGDKGKARGKPQPKPTTTRVHAPPRMGRFSIPQAGDHKPQPAGDKGKARGKPQPKPT
147-159ARRMPRPKPMNSR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MDTRNATQGEAPEVLPEPNHPSQTEQPEQPEPTTIRVHAPPRMGRFSIPQAGDHKPQPAGDKGKARGKPQPKPTTTRVHAPPRMGRFSIPQAGDHKPQPAGDKGKARGKPQPKPTTTRVHAPPRMGRFSAPQAEEQGPQATRVDKEARRMPRPKPMNSRIPIRPRLGPFSAPRLTQTEVQARTNQDATRRKPQPFPGPDVLDSPTKGTNITTVDIPSSDAEADRDRSPTRQERERHNRRRTAKSAPAPADVESMTRAAQTPQIASSPSVSEASMNPIEESPSIRLQRRRRDKPREEWIAMSAAAPRADFAPESSAPETLSGAWGMMGTSTGGSVPTLSLLSSDAEIDIHGGPNQRQRQEKGDGRRSRDMEESALSPRPDTGPISTSSEMSKRIDGSKSTTRKGCSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.19
4 0.22
5 0.25
6 0.28
7 0.26
8 0.31
9 0.38
10 0.47
11 0.5
12 0.47
13 0.48
14 0.52
15 0.54
16 0.49
17 0.47
18 0.41
19 0.39
20 0.38
21 0.34
22 0.33
23 0.36
24 0.4
25 0.39
26 0.45
27 0.47
28 0.5
29 0.55
30 0.51
31 0.46
32 0.47
33 0.49
34 0.49
35 0.43
36 0.4
37 0.39
38 0.43
39 0.46
40 0.43
41 0.39
42 0.34
43 0.35
44 0.36
45 0.39
46 0.4
47 0.42
48 0.47
49 0.5
50 0.57
51 0.59
52 0.6
53 0.61
54 0.65
55 0.67
56 0.7
57 0.74
58 0.71
59 0.74
60 0.76
61 0.77
62 0.7
63 0.7
64 0.68
65 0.68
66 0.67
67 0.66
68 0.67
69 0.64
70 0.66
71 0.58
72 0.52
73 0.47
74 0.49
75 0.5
76 0.44
77 0.4
78 0.39
79 0.43
80 0.46
81 0.43
82 0.39
83 0.34
84 0.35
85 0.36
86 0.39
87 0.4
88 0.42
89 0.47
90 0.5
91 0.57
92 0.59
93 0.6
94 0.61
95 0.65
96 0.67
97 0.7
98 0.74
99 0.71
100 0.74
101 0.76
102 0.77
103 0.7
104 0.7
105 0.68
106 0.68
107 0.67
108 0.66
109 0.67
110 0.64
111 0.65
112 0.56
113 0.49
114 0.42
115 0.44
116 0.43
117 0.37
118 0.31
119 0.3
120 0.32
121 0.31
122 0.28
123 0.26
124 0.19
125 0.19
126 0.19
127 0.17
128 0.15
129 0.19
130 0.25
131 0.23
132 0.29
133 0.36
134 0.42
135 0.49
136 0.55
137 0.55
138 0.58
139 0.63
140 0.65
141 0.68
142 0.68
143 0.69
144 0.67
145 0.7
146 0.68
147 0.7
148 0.67
149 0.6
150 0.58
151 0.51
152 0.53
153 0.47
154 0.43
155 0.37
156 0.38
157 0.37
158 0.32
159 0.31
160 0.28
161 0.28
162 0.26
163 0.28
164 0.28
165 0.28
166 0.29
167 0.31
168 0.29
169 0.29
170 0.29
171 0.26
172 0.27
173 0.32
174 0.36
175 0.42
176 0.47
177 0.48
178 0.51
179 0.56
180 0.58
181 0.55
182 0.57
183 0.52
184 0.48
185 0.46
186 0.42
187 0.38
188 0.28
189 0.25
190 0.19
191 0.15
192 0.12
193 0.12
194 0.1
195 0.11
196 0.11
197 0.12
198 0.11
199 0.1
200 0.1
201 0.1
202 0.11
203 0.08
204 0.07
205 0.07
206 0.06
207 0.07
208 0.08
209 0.11
210 0.11
211 0.13
212 0.13
213 0.15
214 0.21
215 0.28
216 0.32
217 0.38
218 0.42
219 0.5
220 0.61
221 0.71
222 0.75
223 0.76
224 0.8
225 0.79
226 0.84
227 0.78
228 0.75
229 0.74
230 0.7
231 0.69
232 0.63
233 0.58
234 0.5
235 0.45
236 0.38
237 0.28
238 0.22
239 0.14
240 0.12
241 0.09
242 0.09
243 0.08
244 0.08
245 0.1
246 0.11
247 0.11
248 0.11
249 0.12
250 0.12
251 0.12
252 0.13
253 0.11
254 0.12
255 0.11
256 0.1
257 0.11
258 0.1
259 0.15
260 0.15
261 0.14
262 0.13
263 0.13
264 0.14
265 0.13
266 0.15
267 0.13
268 0.18
269 0.22
270 0.27
271 0.35
272 0.43
273 0.54
274 0.62
275 0.7
276 0.75
277 0.83
278 0.86
279 0.88
280 0.9
281 0.88
282 0.8
283 0.71
284 0.62
285 0.52
286 0.43
287 0.34
288 0.25
289 0.18
290 0.15
291 0.13
292 0.12
293 0.1
294 0.11
295 0.11
296 0.1
297 0.13
298 0.13
299 0.18
300 0.18
301 0.18
302 0.17
303 0.18
304 0.17
305 0.12
306 0.13
307 0.08
308 0.07
309 0.07
310 0.06
311 0.06
312 0.05
313 0.05
314 0.04
315 0.04
316 0.04
317 0.04
318 0.05
319 0.05
320 0.05
321 0.05
322 0.06
323 0.06
324 0.06
325 0.06
326 0.07
327 0.08
328 0.08
329 0.08
330 0.07
331 0.07
332 0.07
333 0.09
334 0.08
335 0.09
336 0.1
337 0.13
338 0.17
339 0.26
340 0.33
341 0.37
342 0.43
343 0.46
344 0.51
345 0.58
346 0.63
347 0.65
348 0.68
349 0.7
350 0.71
351 0.77
352 0.72
353 0.66
354 0.64
355 0.55
356 0.48
357 0.43
358 0.37
359 0.32
360 0.35
361 0.31
362 0.26
363 0.26
364 0.24
365 0.24
366 0.24
367 0.23
368 0.21
369 0.24
370 0.3
371 0.29
372 0.29
373 0.3
374 0.31
375 0.31
376 0.31
377 0.31
378 0.28
379 0.32
380 0.36
381 0.35
382 0.39
383 0.46
384 0.51
385 0.54
386 0.57
387 0.57