Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YP37

Protein Details
Accession G8YP37    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-72SKYVVDYKRKQSQRDKQSRGRIRATSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MIPSKTYAESKELGYKEEAIEGILRIARQEQKKGNKKITEGKLENLSKYVVDYKRKQSQRDKQSRGRIRATSQPSADSIRPSSETRRCPPLFDKFTLPKKTPVETKKERRAAVPFRFTFKNIERVIIETLEILANLIDNMHLFSKLPMFPKALTRLLRQTNRIWVLILIFLIRKTISQLLNVIRKERKVNTELAILRSNKNANLLESKDDENNIFRKYDKVLKDLKFDRMMLIIELVGNFLDMIFNAVELYRFPVPEWFMSGLNIASMGMTIYRMNKDTEYLDDDISDDLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.27
4 0.28
5 0.24
6 0.17
7 0.17
8 0.15
9 0.15
10 0.14
11 0.13
12 0.12
13 0.17
14 0.24
15 0.28
16 0.36
17 0.43
18 0.52
19 0.63
20 0.71
21 0.75
22 0.74
23 0.75
24 0.77
25 0.77
26 0.76
27 0.69
28 0.64
29 0.64
30 0.61
31 0.55
32 0.46
33 0.38
34 0.28
35 0.27
36 0.31
37 0.28
38 0.33
39 0.39
40 0.46
41 0.56
42 0.61
43 0.68
44 0.71
45 0.75
46 0.78
47 0.82
48 0.82
49 0.82
50 0.87
51 0.88
52 0.84
53 0.81
54 0.74
55 0.67
56 0.67
57 0.65
58 0.6
59 0.51
60 0.45
61 0.4
62 0.4
63 0.37
64 0.31
65 0.25
66 0.22
67 0.24
68 0.24
69 0.31
70 0.34
71 0.4
72 0.41
73 0.49
74 0.47
75 0.49
76 0.52
77 0.54
78 0.52
79 0.48
80 0.51
81 0.49
82 0.58
83 0.59
84 0.56
85 0.53
86 0.51
87 0.52
88 0.53
89 0.51
90 0.52
91 0.56
92 0.64
93 0.66
94 0.7
95 0.67
96 0.62
97 0.65
98 0.64
99 0.62
100 0.61
101 0.52
102 0.5
103 0.5
104 0.48
105 0.45
106 0.38
107 0.39
108 0.3
109 0.31
110 0.27
111 0.28
112 0.28
113 0.21
114 0.19
115 0.1
116 0.1
117 0.08
118 0.07
119 0.05
120 0.04
121 0.03
122 0.03
123 0.03
124 0.02
125 0.03
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.08
132 0.1
133 0.12
134 0.13
135 0.14
136 0.15
137 0.18
138 0.22
139 0.25
140 0.25
141 0.26
142 0.31
143 0.37
144 0.39
145 0.39
146 0.37
147 0.39
148 0.39
149 0.37
150 0.3
151 0.23
152 0.2
153 0.17
154 0.15
155 0.08
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.12
163 0.12
164 0.13
165 0.17
166 0.22
167 0.28
168 0.29
169 0.32
170 0.3
171 0.32
172 0.36
173 0.36
174 0.37
175 0.33
176 0.36
177 0.33
178 0.38
179 0.37
180 0.35
181 0.37
182 0.33
183 0.31
184 0.31
185 0.31
186 0.24
187 0.27
188 0.24
189 0.21
190 0.24
191 0.24
192 0.24
193 0.25
194 0.26
195 0.23
196 0.23
197 0.22
198 0.21
199 0.22
200 0.21
201 0.19
202 0.18
203 0.19
204 0.22
205 0.29
206 0.29
207 0.31
208 0.39
209 0.41
210 0.49
211 0.51
212 0.53
213 0.49
214 0.46
215 0.41
216 0.34
217 0.31
218 0.23
219 0.2
220 0.13
221 0.1
222 0.1
223 0.09
224 0.06
225 0.06
226 0.05
227 0.04
228 0.04
229 0.03
230 0.06
231 0.05
232 0.05
233 0.05
234 0.06
235 0.06
236 0.07
237 0.11
238 0.11
239 0.11
240 0.12
241 0.16
242 0.19
243 0.2
244 0.24
245 0.22
246 0.2
247 0.21
248 0.22
249 0.17
250 0.14
251 0.13
252 0.09
253 0.06
254 0.06
255 0.05
256 0.04
257 0.06
258 0.07
259 0.11
260 0.14
261 0.16
262 0.19
263 0.19
264 0.22
265 0.23
266 0.26
267 0.27
268 0.26
269 0.25
270 0.23
271 0.23