Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UG23

Protein Details
Accession A0A1Q5UG23   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-129TEIFRKLNVHKKHDRRPHPRRRPLTSRKGGTCHBasic
NLS Segment(s)
PositionSequence
106-124HKKHDRRPHPRRRPLTSRK
Subcellular Location(s) plas 20, E.R. 2, mito 1, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR003377  Cornichon  
IPR033466  Cornichon_conserved  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF03311  Cornichon  
PROSITE View protein in PROSITE  
PS01340  CORNICHON  
Amino Acid Sequences MSGEAWLYLLSVLINAVNLFLQVFFTIMYSDLECDYINPIDLCNRLNAYIIPEAAVHAFLTFLFVINGYWLAIFLNLPLLAFNAKKIYDNQHLLDATEIFRKLNVHKKHDRRPHPRRRPLTSRKGGTCHAPWPFQLAPGRRYIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.06
15 0.08
16 0.07
17 0.08
18 0.08
19 0.09
20 0.08
21 0.09
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.12
28 0.13
29 0.13
30 0.12
31 0.13
32 0.12
33 0.13
34 0.13
35 0.14
36 0.14
37 0.13
38 0.12
39 0.11
40 0.11
41 0.1
42 0.1
43 0.06
44 0.05
45 0.05
46 0.04
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.06
69 0.06
70 0.08
71 0.08
72 0.09
73 0.11
74 0.17
75 0.23
76 0.26
77 0.27
78 0.29
79 0.28
80 0.27
81 0.26
82 0.21
83 0.15
84 0.15
85 0.14
86 0.1
87 0.11
88 0.13
89 0.17
90 0.26
91 0.33
92 0.39
93 0.49
94 0.58
95 0.68
96 0.76
97 0.82
98 0.84
99 0.87
100 0.9
101 0.92
102 0.93
103 0.92
104 0.91
105 0.91
106 0.9
107 0.9
108 0.89
109 0.86
110 0.81
111 0.77
112 0.7
113 0.66
114 0.59
115 0.55
116 0.5
117 0.44
118 0.38
119 0.41
120 0.38
121 0.37
122 0.41
123 0.39
124 0.37