Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q5UID3

Protein Details
Accession A0A1Q5UID3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-73RRDGVSKPRKGRPKKLTEADKERIBasic
NLS Segment(s)
PositionSequence
51-65RDGVSKPRKGRPKKL
Subcellular Location(s) nucl 19.5, cyto_nucl 10.833, mito 5.5, cyto_mito 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Amino Acid Sequences MARSKELTPTLRARICELHDIGWGYRRIQKRYPWIPLSTVRYTIIKEAERRDGVSKPRKGRPKKLTEADKERIIKVIDENPRVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.42
4 0.37
5 0.3
6 0.29
7 0.3
8 0.26
9 0.27
10 0.25
11 0.2
12 0.26
13 0.31
14 0.33
15 0.37
16 0.43
17 0.47
18 0.53
19 0.59
20 0.57
21 0.53
22 0.51
23 0.51
24 0.51
25 0.42
26 0.36
27 0.29
28 0.26
29 0.25
30 0.23
31 0.22
32 0.18
33 0.2
34 0.21
35 0.25
36 0.25
37 0.27
38 0.27
39 0.28
40 0.35
41 0.41
42 0.46
43 0.48
44 0.55
45 0.64
46 0.7
47 0.76
48 0.77
49 0.78
50 0.8
51 0.83
52 0.85
53 0.84
54 0.85
55 0.79
56 0.77
57 0.7
58 0.61
59 0.55
60 0.46
61 0.38
62 0.34
63 0.37
64 0.37