Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y2X9

Protein Details
Accession G8Y2X9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-43KPAAKKTASSDPKKRTKTRKETYSSYHydrophilic
NLS Segment(s)
PositionSequence
4-37KAEKKPASKAPAEKKPAAKKTASSDPKKRTKTRK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKAEKKPASKAPAEKKPAAKKTASSDPKKRTKTRKETYSSYIYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRSVTKYSSATN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.73
4 0.73
5 0.76
6 0.76
7 0.72
8 0.64
9 0.59
10 0.59
11 0.63
12 0.63
13 0.62
14 0.64
15 0.68
16 0.75
17 0.79
18 0.81
19 0.82
20 0.83
21 0.85
22 0.86
23 0.86
24 0.83
25 0.8
26 0.76
27 0.75
28 0.66
29 0.57
30 0.54
31 0.45
32 0.42
33 0.41
34 0.4
35 0.35
36 0.38
37 0.38
38 0.36
39 0.37
40 0.35
41 0.32
42 0.31
43 0.29
44 0.24
45 0.21
46 0.16
47 0.15
48 0.15
49 0.13
50 0.09
51 0.08
52 0.09
53 0.09
54 0.09
55 0.08
56 0.09
57 0.09
58 0.08
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.07
70 0.11
71 0.16
72 0.19
73 0.22
74 0.24
75 0.25
76 0.26
77 0.28
78 0.3
79 0.3
80 0.33
81 0.32
82 0.34
83 0.32
84 0.31
85 0.32
86 0.28
87 0.22
88 0.17
89 0.15
90 0.11
91 0.11
92 0.12
93 0.09
94 0.09
95 0.09
96 0.1
97 0.1
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.13
104 0.16
105 0.18
106 0.19
107 0.21
108 0.21
109 0.23