Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5ULE8

Protein Details
Accession A0A1Q5ULE8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
96-133GAATKVEKPSRQQRKQRKNRSKKFRGTAKTKGPKKNKDBasic
NLS Segment(s)
PositionSequence
100-133KVEKPSRQQRKQRKNRSKKFRGTAKTKGPKKNKD
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTIRTRKFIRNPLLARKQMVVDVLHPNRPNVSKDELREKLADLYKSNKDQVSVFGFRTQYGGGKSTGFALVYDSAEALKKFEPAYRLVRIGAATKVEKPSRQQRKQRKNRSKKFRGTAKTKGPKKNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.3
25 0.34
26 0.42
27 0.41
28 0.41
29 0.39
30 0.36
31 0.35
32 0.35
33 0.33
34 0.25
35 0.28
36 0.3
37 0.32
38 0.33
39 0.28
40 0.25
41 0.23
42 0.25
43 0.26
44 0.23
45 0.21
46 0.22
47 0.21
48 0.2
49 0.21
50 0.18
51 0.13
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.07
62 0.08
63 0.08
64 0.07
65 0.07
66 0.06
67 0.08
68 0.08
69 0.08
70 0.07
71 0.09
72 0.09
73 0.12
74 0.13
75 0.16
76 0.22
77 0.23
78 0.24
79 0.23
80 0.24
81 0.22
82 0.22
83 0.2
84 0.18
85 0.17
86 0.19
87 0.25
88 0.27
89 0.28
90 0.34
91 0.43
92 0.51
93 0.59
94 0.67
95 0.72
96 0.8
97 0.89
98 0.93
99 0.94
100 0.94
101 0.95
102 0.96
103 0.96
104 0.95
105 0.94
106 0.92
107 0.91
108 0.88
109 0.87
110 0.87
111 0.87
112 0.86
113 0.86