Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UNH4

Protein Details
Accession A0A1Q5UNH4   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
157-186ATTISDEKPQKKKKRNFREKLLRRHKDERWBasic
272-322EEHQLRDPSTRRNNRQRTRERRQSAAPPSAPSSRTSSPRKKDRRSVPGGYTHydrophilic
NLS Segment(s)
PositionSequence
164-182KPQKKKKRNFREKLLRRHK
285-315NRQRTRERRQSAAPPSAPSSRTSSPRKKDRR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, plas 4, cyto 2.5, mito 1, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPVQQIGDFPDIPLKSVEVRDVAQDIPTDASPAITLNYLSPRADSSAAATKINYGQGTVDPKNIKMQGLMALFALIGAAFVLGGIWFFFWAKNGGFVWRKGDWEDYKSTVLRRKGPDGRTLSNATKSTKLGGGSVVGYSDDGYTYTDETGTYTETATTISDEKPQKKKKRNFREKLLRRHKDERWEGEADDDMRAYREERPARIGGMNREADGTYHGSDYDSSAPPTHYNRSDMSEVRDYAYEQPRRSRRRDPSGFSFTAGSEDVLSQTTEEHQLRDPSTRRNNRQRTRERRQSAAPPSAPSSRTSSPRKKDRRSVPGGYTEPLDLASAGTRSEYQYSNVDTEDSNGTRSYHHPIPGLTKGYRRDGHGRRRRDSLSDSDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.22
5 0.24
6 0.2
7 0.2
8 0.21
9 0.23
10 0.21
11 0.19
12 0.18
13 0.17
14 0.17
15 0.16
16 0.15
17 0.13
18 0.12
19 0.11
20 0.11
21 0.11
22 0.09
23 0.09
24 0.1
25 0.15
26 0.17
27 0.17
28 0.17
29 0.18
30 0.2
31 0.21
32 0.18
33 0.18
34 0.25
35 0.26
36 0.26
37 0.25
38 0.25
39 0.26
40 0.29
41 0.24
42 0.16
43 0.16
44 0.19
45 0.27
46 0.25
47 0.3
48 0.28
49 0.29
50 0.35
51 0.36
52 0.32
53 0.26
54 0.26
55 0.25
56 0.24
57 0.24
58 0.17
59 0.15
60 0.14
61 0.13
62 0.11
63 0.04
64 0.03
65 0.03
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.06
78 0.09
79 0.09
80 0.12
81 0.12
82 0.19
83 0.22
84 0.23
85 0.27
86 0.26
87 0.27
88 0.26
89 0.33
90 0.29
91 0.31
92 0.33
93 0.3
94 0.32
95 0.33
96 0.36
97 0.36
98 0.38
99 0.41
100 0.41
101 0.47
102 0.52
103 0.54
104 0.58
105 0.57
106 0.55
107 0.52
108 0.53
109 0.47
110 0.44
111 0.44
112 0.38
113 0.34
114 0.31
115 0.28
116 0.26
117 0.23
118 0.18
119 0.16
120 0.14
121 0.12
122 0.11
123 0.1
124 0.07
125 0.07
126 0.07
127 0.06
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.06
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.06
143 0.07
144 0.06
145 0.07
146 0.08
147 0.08
148 0.15
149 0.21
150 0.28
151 0.38
152 0.47
153 0.56
154 0.65
155 0.74
156 0.78
157 0.84
158 0.88
159 0.87
160 0.88
161 0.89
162 0.88
163 0.9
164 0.91
165 0.86
166 0.82
167 0.81
168 0.74
169 0.73
170 0.7
171 0.64
172 0.58
173 0.52
174 0.45
175 0.38
176 0.35
177 0.26
178 0.19
179 0.14
180 0.09
181 0.08
182 0.08
183 0.08
184 0.1
185 0.17
186 0.19
187 0.2
188 0.24
189 0.24
190 0.25
191 0.27
192 0.26
193 0.22
194 0.25
195 0.25
196 0.21
197 0.21
198 0.2
199 0.17
200 0.16
201 0.15
202 0.1
203 0.1
204 0.09
205 0.09
206 0.09
207 0.11
208 0.13
209 0.11
210 0.12
211 0.12
212 0.13
213 0.16
214 0.19
215 0.22
216 0.2
217 0.22
218 0.23
219 0.26
220 0.28
221 0.27
222 0.29
223 0.28
224 0.27
225 0.25
226 0.24
227 0.22
228 0.25
229 0.33
230 0.33
231 0.31
232 0.39
233 0.47
234 0.54
235 0.59
236 0.62
237 0.63
238 0.69
239 0.75
240 0.73
241 0.73
242 0.74
243 0.68
244 0.59
245 0.51
246 0.4
247 0.34
248 0.27
249 0.18
250 0.1
251 0.1
252 0.09
253 0.09
254 0.09
255 0.07
256 0.07
257 0.08
258 0.14
259 0.14
260 0.15
261 0.17
262 0.21
263 0.22
264 0.3
265 0.31
266 0.35
267 0.45
268 0.54
269 0.61
270 0.69
271 0.78
272 0.8
273 0.88
274 0.89
275 0.89
276 0.9
277 0.91
278 0.85
279 0.8
280 0.78
281 0.76
282 0.74
283 0.72
284 0.64
285 0.56
286 0.55
287 0.54
288 0.48
289 0.4
290 0.39
291 0.35
292 0.4
293 0.47
294 0.53
295 0.58
296 0.68
297 0.77
298 0.79
299 0.84
300 0.87
301 0.87
302 0.86
303 0.83
304 0.78
305 0.77
306 0.7
307 0.61
308 0.52
309 0.41
310 0.33
311 0.26
312 0.2
313 0.11
314 0.09
315 0.09
316 0.08
317 0.08
318 0.09
319 0.1
320 0.11
321 0.15
322 0.15
323 0.17
324 0.21
325 0.24
326 0.24
327 0.23
328 0.23
329 0.2
330 0.21
331 0.24
332 0.21
333 0.19
334 0.19
335 0.19
336 0.21
337 0.23
338 0.28
339 0.27
340 0.3
341 0.31
342 0.33
343 0.39
344 0.43
345 0.46
346 0.42
347 0.44
348 0.45
349 0.52
350 0.52
351 0.52
352 0.56
353 0.6
354 0.67
355 0.7
356 0.75
357 0.71
358 0.76
359 0.74
360 0.71
361 0.67
362 0.64