Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UQH6

Protein Details
Accession A0A1Q5UQH6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78LSERKLSKDKVRKNHRQLMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 6, mito_nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF03656  Pam16  
CDD cd06257  DnaJ  
Amino Acid Sequences MASILSIGLGVGVAAFLGRAGLVAYRRSQGGVNAAGKAFYKGGFEPRMTRREASLILELSERKLSKDKVRKNHRQLMLLNHPDRGGSPYLATKINEAKEFLDKHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.05
9 0.07
10 0.1
11 0.11
12 0.13
13 0.13
14 0.14
15 0.15
16 0.14
17 0.17
18 0.2
19 0.2
20 0.2
21 0.19
22 0.19
23 0.18
24 0.18
25 0.14
26 0.09
27 0.1
28 0.09
29 0.14
30 0.16
31 0.17
32 0.22
33 0.26
34 0.29
35 0.29
36 0.28
37 0.24
38 0.24
39 0.24
40 0.21
41 0.18
42 0.15
43 0.14
44 0.15
45 0.14
46 0.13
47 0.15
48 0.13
49 0.12
50 0.17
51 0.2
52 0.29
53 0.38
54 0.46
55 0.53
56 0.64
57 0.73
58 0.77
59 0.83
60 0.79
61 0.75
62 0.7
63 0.69
64 0.68
65 0.66
66 0.58
67 0.5
68 0.45
69 0.39
70 0.36
71 0.3
72 0.23
73 0.14
74 0.15
75 0.18
76 0.2
77 0.23
78 0.23
79 0.24
80 0.28
81 0.31
82 0.31
83 0.3
84 0.3
85 0.34