Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6RPP2

Protein Details
Accession A0A2R6RPP2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-36SSSSGGKAAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
11-30SSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPSSSSGGKAAKKKKWSKGKVKDKAQHAVTLDKPLYDRIMKEVPTFRFISQSILIERLKINGSLARVAIKHLERDGQIKRIVHHSAQLIYSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.44
4 0.47
5 0.56
6 0.63
7 0.7
8 0.77
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.83
17 0.81
18 0.71
19 0.64
20 0.55
21 0.5
22 0.4
23 0.39
24 0.32
25 0.24
26 0.23
27 0.2
28 0.2
29 0.16
30 0.15
31 0.14
32 0.17
33 0.18
34 0.2
35 0.24
36 0.23
37 0.25
38 0.27
39 0.22
40 0.22
41 0.22
42 0.22
43 0.18
44 0.19
45 0.16
46 0.18
47 0.18
48 0.17
49 0.16
50 0.15
51 0.14
52 0.13
53 0.13
54 0.12
55 0.13
56 0.13
57 0.14
58 0.14
59 0.13
60 0.14
61 0.19
62 0.18
63 0.19
64 0.19
65 0.23
66 0.22
67 0.28
68 0.31
69 0.31
70 0.35
71 0.34
72 0.35
73 0.38
74 0.41
75 0.36
76 0.37
77 0.35
78 0.33