Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NKC1

Protein Details
Accession A0A2R6NKC1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SDSIPRIPRRSKKDDDPKMIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.166, nucl 12.5, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MSDSIPRIPRRSKKDDDPKMIGLWKIGRTIGKGSSGTWVHFLELKSADSRIKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.8
4 0.76
5 0.69
6 0.63
7 0.57
8 0.47
9 0.37
10 0.31
11 0.24
12 0.19
13 0.18
14 0.16
15 0.15
16 0.17
17 0.16
18 0.16
19 0.15
20 0.14
21 0.19
22 0.2
23 0.19
24 0.2
25 0.19
26 0.17
27 0.2
28 0.2
29 0.18
30 0.19
31 0.2
32 0.19
33 0.2
34 0.22