Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R4Z5

Protein Details
Accession C4R4Z5    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-61RNNVSFRKTLKKNSKSYQKKLQKDKEQSKKQTLVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.333, nucl 8, mito_nucl 7.999, cyto 7.5, mito 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0030943  F:mitochondrion targeting sequence binding  
GO:0008320  F:protein transmembrane transporter activity  
GO:0030150  P:protein import into mitochondrial matrix  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
GO:0016031  P:tRNA import into mitochondrion  
KEGG ppa:PAS_chr3_0584  -  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MSKTFTITALAALGATVGYAIYFDYQRRNNVSFRKTLKKNSKSYQKKLQKDKEQSKKQTLVLLRKRLEQALKEEPVLSDVAEKEQYFYKHITLGEQLSSVPNKEIDAAIEFYKALSTYPNPTSILNIYQKSVREDIYELVVMLIAIQPPQAVVNILGESSLQSSHGDDVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.02
6 0.03
7 0.03
8 0.05
9 0.07
10 0.09
11 0.17
12 0.2
13 0.26
14 0.31
15 0.34
16 0.39
17 0.46
18 0.49
19 0.5
20 0.53
21 0.59
22 0.59
23 0.67
24 0.71
25 0.72
26 0.76
27 0.78
28 0.82
29 0.82
30 0.83
31 0.84
32 0.83
33 0.83
34 0.85
35 0.86
36 0.85
37 0.86
38 0.89
39 0.88
40 0.89
41 0.87
42 0.84
43 0.79
44 0.7
45 0.65
46 0.61
47 0.6
48 0.58
49 0.59
50 0.53
51 0.51
52 0.51
53 0.48
54 0.45
55 0.37
56 0.35
57 0.33
58 0.32
59 0.29
60 0.28
61 0.24
62 0.22
63 0.2
64 0.14
65 0.08
66 0.07
67 0.08
68 0.09
69 0.09
70 0.09
71 0.12
72 0.12
73 0.13
74 0.14
75 0.13
76 0.14
77 0.14
78 0.15
79 0.14
80 0.14
81 0.12
82 0.11
83 0.11
84 0.1
85 0.11
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.09
94 0.1
95 0.1
96 0.1
97 0.1
98 0.09
99 0.09
100 0.08
101 0.06
102 0.07
103 0.09
104 0.13
105 0.15
106 0.17
107 0.18
108 0.18
109 0.21
110 0.2
111 0.24
112 0.25
113 0.24
114 0.23
115 0.25
116 0.27
117 0.29
118 0.29
119 0.24
120 0.2
121 0.21
122 0.21
123 0.21
124 0.19
125 0.15
126 0.13
127 0.12
128 0.1
129 0.08
130 0.08
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.07
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.07
149 0.08
150 0.1