Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YPN4

Protein Details
Accession G8YPN4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HTAHNQNKKAHRNGIKKPRTBasic
NLS Segment(s)
PositionSequence
14-58KKAHRNGIKKPRTHKYPSLKGVDAKFRRNHRYALHGTAKALAKAR
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQNKKAHRNGIKKPRTHKYPSLKGVDAKFRRNHRYALHGTAKALAKARAEKAGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.78
4 0.77
5 0.75
6 0.76
7 0.8
8 0.79
9 0.76
10 0.78
11 0.77
12 0.75
13 0.73
14 0.72
15 0.71
16 0.72
17 0.72
18 0.69
19 0.61
20 0.57
21 0.53
22 0.54
23 0.48
24 0.45
25 0.45
26 0.48
27 0.53
28 0.52
29 0.54
30 0.47
31 0.52
32 0.49
33 0.52
34 0.51
35 0.45
36 0.43
37 0.44
38 0.42
39 0.37
40 0.35
41 0.29
42 0.27
43 0.31
44 0.33
45 0.34