Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6S4T6

Protein Details
Accession A0A2R6S4T6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25KSMAGCGWGRRRRRAKAAKADAEVAHydrophilic
NLS Segment(s)
PositionSequence
10-19RRRRRAKAAK
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences KSMAGCGWGRRRRRAKAAKADAEVAPQKSIQTVTAKKATAHHGQIDVNPSASMEGSGTGIPRASDAKARRARHVGSMSLDEKLRLLEEVAAALNKDQKINRMYLPASHHGSGTGSYSRGSGAHRHSSVPPSTPEEGSDSSDIEMFNSDEVFNADEIDDPMEMTPTEVYDSDTDMVPPATDLKRCHAMAVVVHVEDVNSNGPEQTKEPEPEPEVVPATSVPDKGNGQKRNQDEDAEMEGGGIPPVASTIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.87
4 0.9
5 0.87
6 0.81
7 0.75
8 0.65
9 0.61
10 0.55
11 0.45
12 0.36
13 0.28
14 0.25
15 0.23
16 0.23
17 0.2
18 0.23
19 0.26
20 0.31
21 0.36
22 0.37
23 0.37
24 0.4
25 0.43
26 0.42
27 0.41
28 0.39
29 0.36
30 0.37
31 0.38
32 0.38
33 0.33
34 0.26
35 0.22
36 0.18
37 0.15
38 0.14
39 0.11
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.09
51 0.16
52 0.19
53 0.29
54 0.37
55 0.4
56 0.44
57 0.48
58 0.48
59 0.49
60 0.49
61 0.42
62 0.36
63 0.39
64 0.34
65 0.31
66 0.29
67 0.21
68 0.18
69 0.15
70 0.13
71 0.08
72 0.08
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.06
79 0.07
80 0.1
81 0.1
82 0.12
83 0.12
84 0.17
85 0.19
86 0.21
87 0.22
88 0.22
89 0.21
90 0.23
91 0.27
92 0.27
93 0.28
94 0.26
95 0.25
96 0.21
97 0.21
98 0.18
99 0.15
100 0.11
101 0.09
102 0.08
103 0.09
104 0.09
105 0.09
106 0.1
107 0.12
108 0.16
109 0.21
110 0.21
111 0.23
112 0.24
113 0.27
114 0.27
115 0.24
116 0.22
117 0.21
118 0.22
119 0.2
120 0.2
121 0.19
122 0.19
123 0.19
124 0.18
125 0.13
126 0.12
127 0.13
128 0.12
129 0.09
130 0.08
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.06
145 0.05
146 0.05
147 0.06
148 0.05
149 0.06
150 0.05
151 0.05
152 0.06
153 0.06
154 0.08
155 0.08
156 0.09
157 0.1
158 0.1
159 0.1
160 0.09
161 0.09
162 0.07
163 0.07
164 0.1
165 0.11
166 0.15
167 0.16
168 0.2
169 0.27
170 0.27
171 0.27
172 0.25
173 0.24
174 0.21
175 0.25
176 0.22
177 0.16
178 0.16
179 0.15
180 0.13
181 0.12
182 0.12
183 0.09
184 0.08
185 0.08
186 0.09
187 0.1
188 0.12
189 0.13
190 0.16
191 0.2
192 0.22
193 0.23
194 0.28
195 0.3
196 0.31
197 0.31
198 0.3
199 0.27
200 0.24
201 0.23
202 0.17
203 0.2
204 0.19
205 0.19
206 0.16
207 0.18
208 0.22
209 0.29
210 0.39
211 0.41
212 0.46
213 0.52
214 0.58
215 0.62
216 0.61
217 0.56
218 0.48
219 0.46
220 0.44
221 0.37
222 0.3
223 0.22
224 0.2
225 0.18
226 0.15
227 0.11
228 0.06
229 0.05