Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y5M1

Protein Details
Accession G8Y5M1   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
294-320EVGFRYGASRRDRKKDRKVGFDRTGSMHydrophilic
NLS Segment(s)
PositionSequence
303-310RRDRKKDR
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MSAMSLTKAPIPNRLGLGIQQVRYLKRRPAYPQAYKPKLAPLSHPKKDHSSFFQRHLKEWLGPRNMRGEYYRNKYYYPPQDHKPRYIVPDGNTVVEDGKVDVYDNRKVGSDKRDPSLHPFPFNPYCKTASVIPSSLKDKIYEEVAEKGAHVQEVAYRYGIKIPRVEAIIKLREVENSWEQKNLISEELQRFSDVMYRMFPLYEPPVQAENLTEIPTPHKTLHQRFLTISESEPFGPVDAAKVFDLKPAQDILNDLTELKHDDNTESSHKEDLVIGKQVEGDRSLFKFTKSKSGEVGFRYGASRRDRKKDRKVGFDRTGSMVYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.28
4 0.37
5 0.34
6 0.32
7 0.33
8 0.35
9 0.38
10 0.43
11 0.46
12 0.44
13 0.45
14 0.51
15 0.54
16 0.61
17 0.66
18 0.71
19 0.76
20 0.79
21 0.79
22 0.75
23 0.69
24 0.67
25 0.64
26 0.55
27 0.54
28 0.54
29 0.58
30 0.63
31 0.66
32 0.61
33 0.63
34 0.66
35 0.64
36 0.61
37 0.61
38 0.59
39 0.63
40 0.68
41 0.6
42 0.58
43 0.57
44 0.52
45 0.47
46 0.5
47 0.5
48 0.5
49 0.5
50 0.5
51 0.52
52 0.49
53 0.45
54 0.41
55 0.4
56 0.4
57 0.46
58 0.51
59 0.45
60 0.45
61 0.47
62 0.53
63 0.55
64 0.56
65 0.54
66 0.56
67 0.65
68 0.68
69 0.7
70 0.66
71 0.6
72 0.56
73 0.57
74 0.53
75 0.44
76 0.48
77 0.44
78 0.38
79 0.34
80 0.29
81 0.22
82 0.18
83 0.16
84 0.08
85 0.07
86 0.06
87 0.07
88 0.09
89 0.12
90 0.16
91 0.16
92 0.17
93 0.18
94 0.19
95 0.24
96 0.29
97 0.34
98 0.34
99 0.37
100 0.4
101 0.4
102 0.46
103 0.51
104 0.45
105 0.4
106 0.37
107 0.4
108 0.44
109 0.47
110 0.42
111 0.35
112 0.35
113 0.33
114 0.34
115 0.3
116 0.26
117 0.26
118 0.24
119 0.23
120 0.23
121 0.24
122 0.25
123 0.23
124 0.19
125 0.18
126 0.17
127 0.17
128 0.16
129 0.15
130 0.14
131 0.15
132 0.14
133 0.13
134 0.13
135 0.11
136 0.1
137 0.08
138 0.06
139 0.07
140 0.09
141 0.1
142 0.09
143 0.09
144 0.09
145 0.14
146 0.16
147 0.15
148 0.14
149 0.15
150 0.16
151 0.18
152 0.18
153 0.16
154 0.19
155 0.2
156 0.19
157 0.18
158 0.17
159 0.16
160 0.17
161 0.18
162 0.19
163 0.21
164 0.22
165 0.22
166 0.22
167 0.22
168 0.23
169 0.2
170 0.14
171 0.12
172 0.15
173 0.18
174 0.2
175 0.19
176 0.17
177 0.16
178 0.15
179 0.19
180 0.15
181 0.13
182 0.12
183 0.13
184 0.13
185 0.13
186 0.13
187 0.11
188 0.14
189 0.15
190 0.14
191 0.15
192 0.16
193 0.17
194 0.17
195 0.15
196 0.13
197 0.12
198 0.13
199 0.11
200 0.1
201 0.14
202 0.16
203 0.17
204 0.16
205 0.22
206 0.29
207 0.35
208 0.43
209 0.43
210 0.43
211 0.41
212 0.44
213 0.41
214 0.33
215 0.28
216 0.21
217 0.19
218 0.17
219 0.17
220 0.13
221 0.11
222 0.1
223 0.09
224 0.1
225 0.08
226 0.1
227 0.09
228 0.11
229 0.11
230 0.14
231 0.16
232 0.14
233 0.15
234 0.15
235 0.15
236 0.14
237 0.16
238 0.14
239 0.15
240 0.15
241 0.14
242 0.12
243 0.12
244 0.15
245 0.14
246 0.15
247 0.13
248 0.15
249 0.16
250 0.2
251 0.25
252 0.24
253 0.25
254 0.24
255 0.23
256 0.23
257 0.23
258 0.23
259 0.22
260 0.25
261 0.24
262 0.22
263 0.25
264 0.26
265 0.24
266 0.22
267 0.2
268 0.19
269 0.2
270 0.26
271 0.24
272 0.26
273 0.31
274 0.31
275 0.4
276 0.4
277 0.41
278 0.41
279 0.46
280 0.49
281 0.45
282 0.49
283 0.39
284 0.36
285 0.36
286 0.33
287 0.35
288 0.38
289 0.44
290 0.48
291 0.58
292 0.67
293 0.75
294 0.83
295 0.87
296 0.87
297 0.89
298 0.89
299 0.89
300 0.87
301 0.82
302 0.74
303 0.68