Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NU96

Protein Details
Accession A0A2R6NU96    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSSTPKVTKKQKKALAFRERKGKGKHydrophilic
NLS Segment(s)
PositionSequence
8-25TKKQKKALAFRERKGKGK
59-98KGAKKAKESHKEVVEGGKKRKRDNEEGGQEPKAKKKQKGK
Subcellular Location(s) nucl 22.5, mito_nucl 13, mito 2.5
Family & Domain DBs
Amino Acid Sequences MSSTPKVTKKQKKALAFRERKGKGKATTTELDGDNDVPVMENQDLAEAEMEDSVLEGQKGAKKAKESHKEVVEGGKKRKRDNEEGGQEPKAKKKQKGKSGDVVELSASKEEGEGEPSEEKEPKAKTKVKQQKFILFVGESSSHVVDIELDELIIQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.88
4 0.84
5 0.84
6 0.8
7 0.77
8 0.73
9 0.7
10 0.65
11 0.64
12 0.62
13 0.58
14 0.55
15 0.5
16 0.48
17 0.41
18 0.36
19 0.29
20 0.24
21 0.18
22 0.15
23 0.12
24 0.09
25 0.08
26 0.09
27 0.08
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.06
35 0.06
36 0.06
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.09
46 0.12
47 0.14
48 0.16
49 0.2
50 0.28
51 0.37
52 0.45
53 0.48
54 0.51
55 0.52
56 0.51
57 0.47
58 0.47
59 0.44
60 0.4
61 0.42
62 0.4
63 0.4
64 0.42
65 0.48
66 0.47
67 0.49
68 0.51
69 0.53
70 0.54
71 0.56
72 0.56
73 0.51
74 0.49
75 0.43
76 0.42
77 0.41
78 0.42
79 0.45
80 0.52
81 0.59
82 0.65
83 0.73
84 0.71
85 0.72
86 0.7
87 0.66
88 0.57
89 0.49
90 0.39
91 0.31
92 0.25
93 0.16
94 0.12
95 0.08
96 0.07
97 0.07
98 0.07
99 0.09
100 0.09
101 0.11
102 0.12
103 0.14
104 0.16
105 0.17
106 0.17
107 0.2
108 0.24
109 0.29
110 0.36
111 0.42
112 0.46
113 0.55
114 0.66
115 0.69
116 0.75
117 0.75
118 0.75
119 0.71
120 0.67
121 0.6
122 0.5
123 0.41
124 0.36
125 0.3
126 0.22
127 0.21
128 0.19
129 0.15
130 0.14
131 0.14
132 0.1
133 0.1
134 0.1
135 0.07
136 0.07