Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NR52

Protein Details
Accession A0A2R6NR52    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-94DDERKTQVSRKTNKPEWKDEFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15.5, nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000008  C2_dom  
IPR035892  C2_domain_sf  
Pfam View protein in Pfam  
PF00168  C2  
CDD cd00030  C2  
Amino Acid Sequences MAQRGPPIIQDDMQIRSDSEVVLFVTGKLSNGRNEGDTHIDHRSTVVRALDPPEIPGYTKTNKRKYYVTLKIGDDERKTQVSRKTNKPEWKDEFTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.19
4 0.18
5 0.15
6 0.12
7 0.1
8 0.09
9 0.09
10 0.09
11 0.07
12 0.08
13 0.09
14 0.09
15 0.11
16 0.12
17 0.13
18 0.16
19 0.17
20 0.16
21 0.17
22 0.18
23 0.19
24 0.18
25 0.19
26 0.19
27 0.18
28 0.16
29 0.16
30 0.16
31 0.13
32 0.14
33 0.12
34 0.1
35 0.11
36 0.14
37 0.15
38 0.13
39 0.14
40 0.13
41 0.12
42 0.12
43 0.14
44 0.15
45 0.18
46 0.27
47 0.35
48 0.43
49 0.48
50 0.5
51 0.52
52 0.55
53 0.61
54 0.62
55 0.59
56 0.55
57 0.52
58 0.53
59 0.53
60 0.51
61 0.44
62 0.38
63 0.35
64 0.34
65 0.34
66 0.35
67 0.4
68 0.45
69 0.51
70 0.58
71 0.65
72 0.7
73 0.79
74 0.8
75 0.82
76 0.8