Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NP01

Protein Details
Accession A0A2R6NP01    Localization Confidence High Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-46APATETPKRKRGRPPGSKNKKTAAHydrophilic
62-108GEAPPKRGRGRPPKQRKPEDDAAEAEPQPKRKRGRPPKPKPAAPETSBasic
115-134GEASEPVPKRKRGRPRKDASBasic
NLS Segment(s)
PositionSequence
29-48PKRKRGRPPGSKNKKTAAAE
58-104AGASGEAPPKRGRGRPPKQRKPEDDAAEAEPQPKRKRGRPPKPKPAA
121-133VPKRKRGRPRKDA
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSDLAEDPKVDELEEVPGDTDAAPATETPKRKRGRPPGSKNKKTAAAEAATAGSSAAAGASGEAPPKRGRGRPPKQRKPEDDAAEAEPQPKRKRGRPPKPKPAAPETSGDDGAEGEASEPVPKRKRGRPRKDAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.12
5 0.12
6 0.11
7 0.11
8 0.06
9 0.06
10 0.06
11 0.06
12 0.1
13 0.15
14 0.21
15 0.26
16 0.35
17 0.39
18 0.45
19 0.56
20 0.63
21 0.69
22 0.74
23 0.8
24 0.83
25 0.9
26 0.91
27 0.85
28 0.79
29 0.76
30 0.67
31 0.59
32 0.52
33 0.42
34 0.34
35 0.3
36 0.25
37 0.17
38 0.15
39 0.11
40 0.06
41 0.04
42 0.04
43 0.03
44 0.02
45 0.02
46 0.02
47 0.03
48 0.03
49 0.05
50 0.06
51 0.08
52 0.08
53 0.12
54 0.15
55 0.19
56 0.28
57 0.37
58 0.48
59 0.57
60 0.68
61 0.75
62 0.82
63 0.87
64 0.84
65 0.81
66 0.8
67 0.73
68 0.65
69 0.57
70 0.5
71 0.44
72 0.38
73 0.33
74 0.26
75 0.28
76 0.29
77 0.34
78 0.37
79 0.41
80 0.53
81 0.61
82 0.7
83 0.75
84 0.82
85 0.86
86 0.9
87 0.88
88 0.84
89 0.81
90 0.76
91 0.67
92 0.61
93 0.54
94 0.49
95 0.44
96 0.37
97 0.28
98 0.21
99 0.19
100 0.14
101 0.09
102 0.05
103 0.06
104 0.06
105 0.09
106 0.12
107 0.2
108 0.26
109 0.35
110 0.42
111 0.51
112 0.62
113 0.7
114 0.79