Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NQB9

Protein Details
Accession A0A2R6NQB9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-59QVYNAVRRPLRRKVSKKERARLIEEGHydrophilic
NLS Segment(s)
PositionSequence
40-54RRPLRRKVSKKERAR
Subcellular Location(s) nucl 8, cyto 7, cysk 7, mito 5
Family & Domain DBs
Amino Acid Sequences MAGSIRLAGCPTHREDGGDSYYTRNRNSRIEYQQVYNAVRRPLRRKVSKKERARLIEEGTRRLTGECSGYANGIVVKDTKVDPEWTPLQQMMEKRLYDELLQMAATVFWTTRYDPSKPLSKFWGVSYTDLADEVQPRLELEVQRVRDSLELYEIEGEWNGRTCSKATMKEDVYSRVRLVACLHEAVQLLREGNYDRALHDGALVYCGRRYVVVTQSLPIAMRLTDTYSEYIGVHSGLFTASSTHIDFLFHAYHVLSYLSVVMDTPANVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.33
4 0.34
5 0.32
6 0.28
7 0.29
8 0.35
9 0.36
10 0.38
11 0.39
12 0.39
13 0.43
14 0.5
15 0.54
16 0.56
17 0.61
18 0.6
19 0.58
20 0.58
21 0.56
22 0.52
23 0.47
24 0.43
25 0.41
26 0.43
27 0.47
28 0.49
29 0.53
30 0.61
31 0.67
32 0.72
33 0.77
34 0.84
35 0.87
36 0.9
37 0.89
38 0.89
39 0.85
40 0.81
41 0.75
42 0.7
43 0.67
44 0.59
45 0.55
46 0.47
47 0.41
48 0.36
49 0.31
50 0.26
51 0.2
52 0.19
53 0.15
54 0.16
55 0.15
56 0.15
57 0.14
58 0.14
59 0.12
60 0.1
61 0.1
62 0.08
63 0.08
64 0.09
65 0.09
66 0.11
67 0.12
68 0.14
69 0.14
70 0.19
71 0.22
72 0.21
73 0.22
74 0.21
75 0.21
76 0.21
77 0.22
78 0.22
79 0.24
80 0.23
81 0.23
82 0.23
83 0.22
84 0.2
85 0.19
86 0.14
87 0.1
88 0.1
89 0.09
90 0.08
91 0.07
92 0.06
93 0.05
94 0.04
95 0.05
96 0.06
97 0.07
98 0.12
99 0.16
100 0.17
101 0.2
102 0.24
103 0.31
104 0.31
105 0.32
106 0.31
107 0.31
108 0.3
109 0.28
110 0.32
111 0.24
112 0.24
113 0.23
114 0.19
115 0.17
116 0.16
117 0.15
118 0.09
119 0.08
120 0.08
121 0.07
122 0.06
123 0.06
124 0.07
125 0.09
126 0.09
127 0.12
128 0.17
129 0.18
130 0.19
131 0.19
132 0.19
133 0.18
134 0.18
135 0.14
136 0.11
137 0.1
138 0.09
139 0.1
140 0.09
141 0.08
142 0.07
143 0.07
144 0.05
145 0.06
146 0.07
147 0.06
148 0.07
149 0.08
150 0.14
151 0.18
152 0.24
153 0.26
154 0.32
155 0.34
156 0.36
157 0.37
158 0.38
159 0.36
160 0.31
161 0.28
162 0.26
163 0.25
164 0.22
165 0.22
166 0.19
167 0.18
168 0.17
169 0.18
170 0.15
171 0.16
172 0.15
173 0.14
174 0.12
175 0.11
176 0.1
177 0.11
178 0.1
179 0.12
180 0.15
181 0.14
182 0.13
183 0.16
184 0.16
185 0.15
186 0.14
187 0.14
188 0.11
189 0.13
190 0.13
191 0.11
192 0.1
193 0.11
194 0.1
195 0.09
196 0.11
197 0.13
198 0.18
199 0.24
200 0.25
201 0.25
202 0.26
203 0.26
204 0.24
205 0.2
206 0.16
207 0.09
208 0.1
209 0.1
210 0.12
211 0.12
212 0.14
213 0.15
214 0.14
215 0.15
216 0.14
217 0.14
218 0.12
219 0.11
220 0.09
221 0.07
222 0.07
223 0.06
224 0.06
225 0.06
226 0.07
227 0.08
228 0.11
229 0.12
230 0.12
231 0.12
232 0.13
233 0.13
234 0.15
235 0.16
236 0.13
237 0.13
238 0.13
239 0.13
240 0.13
241 0.13
242 0.09
243 0.08
244 0.09
245 0.08
246 0.08
247 0.08
248 0.08
249 0.08