Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8XZE3

Protein Details
Accession G8XZE3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-106KPGDKPKPPVRGPPPKRMKHBasic
NLS Segment(s)
PositionSequence
89-106GDKPKPPVRGPPPKRMKH
Subcellular Location(s) cyto 19.5, cyto_nucl 14, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034099  SmD3  
Gene Ontology GO:0005829  C:cytosol  
GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01721  Sm_D3  
Amino Acid Sequences MSAGIPVKLLNEAQGHIISVELTTGDIYRGKLLENEDNMNLSLYDVTITKGKSGSTSYMEQVFVRGSMIRYVMVPEILKNAPMFFMKPGDKPKPPVRGPPPKRMKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.13
5 0.09
6 0.08
7 0.07
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.07
14 0.08
15 0.09
16 0.1
17 0.1
18 0.12
19 0.15
20 0.19
21 0.2
22 0.22
23 0.21
24 0.21
25 0.21
26 0.19
27 0.15
28 0.1
29 0.08
30 0.05
31 0.06
32 0.05
33 0.06
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.09
40 0.11
41 0.12
42 0.13
43 0.14
44 0.15
45 0.16
46 0.17
47 0.15
48 0.15
49 0.13
50 0.09
51 0.09
52 0.08
53 0.07
54 0.08
55 0.09
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.1
62 0.09
63 0.13
64 0.12
65 0.14
66 0.12
67 0.12
68 0.12
69 0.13
70 0.14
71 0.11
72 0.17
73 0.19
74 0.24
75 0.33
76 0.39
77 0.43
78 0.49
79 0.56
80 0.6
81 0.62
82 0.67
83 0.69
84 0.73
85 0.75
86 0.79