Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6RLS1

Protein Details
Accession A0A2R6RLS1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45SAPPAVPKPIKKKNGKFFRDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_mito 8.166, extr 8, cyto_nucl 7.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MALIIPSLSAPIASKESENSLFMVASAPPAVPKPIKKKNGKFFRDVSGLELLDPSDSDSGFVQSPGAGAPSINGILEGLRGDDRAAPAVSGWHLISHQNTFRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.19
4 0.2
5 0.2
6 0.18
7 0.16
8 0.15
9 0.15
10 0.14
11 0.09
12 0.08
13 0.08
14 0.07
15 0.07
16 0.08
17 0.11
18 0.13
19 0.2
20 0.29
21 0.38
22 0.48
23 0.57
24 0.66
25 0.73
26 0.81
27 0.78
28 0.74
29 0.67
30 0.63
31 0.57
32 0.48
33 0.39
34 0.31
35 0.27
36 0.21
37 0.19
38 0.13
39 0.09
40 0.09
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.06
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.06
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.09
70 0.1
71 0.12
72 0.12
73 0.11
74 0.11
75 0.12
76 0.13
77 0.13
78 0.12
79 0.1
80 0.11
81 0.15
82 0.18
83 0.22