Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NZK0

Protein Details
Accession A0A2R6NZK0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
7-32KADAIRPVNKRRKTDKDDTRKNRDATBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040315  WDR46/Utp7  
Amino Acid Sequences MDSLFAKADAIRPVNKRRKTDKDDTRKNRDATGVQDDRTLNSVAQSTSIPKSLRPTSPPPENLPKYSHIANKRLRSQLTRQSAHAARSKALVKDAELLLAEDMGLMQVEGDMEKTWRVGQSEVLAAAGQEAARGRKEWTLDGGPYRSRYTRNGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.65
4 0.69
5 0.76
6 0.79
7 0.83
8 0.83
9 0.84
10 0.88
11 0.89
12 0.89
13 0.87
14 0.8
15 0.72
16 0.66
17 0.57
18 0.51
19 0.51
20 0.45
21 0.37
22 0.39
23 0.36
24 0.32
25 0.32
26 0.27
27 0.17
28 0.15
29 0.16
30 0.11
31 0.12
32 0.12
33 0.13
34 0.13
35 0.17
36 0.16
37 0.16
38 0.22
39 0.26
40 0.29
41 0.31
42 0.37
43 0.39
44 0.46
45 0.48
46 0.47
47 0.53
48 0.52
49 0.49
50 0.45
51 0.41
52 0.37
53 0.37
54 0.38
55 0.33
56 0.38
57 0.43
58 0.46
59 0.49
60 0.5
61 0.48
62 0.46
63 0.47
64 0.48
65 0.49
66 0.45
67 0.4
68 0.42
69 0.42
70 0.42
71 0.41
72 0.33
73 0.25
74 0.27
75 0.29
76 0.23
77 0.24
78 0.2
79 0.16
80 0.18
81 0.18
82 0.15
83 0.12
84 0.12
85 0.09
86 0.09
87 0.08
88 0.04
89 0.04
90 0.03
91 0.03
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.08
103 0.1
104 0.11
105 0.11
106 0.13
107 0.15
108 0.16
109 0.16
110 0.15
111 0.12
112 0.11
113 0.1
114 0.09
115 0.06
116 0.06
117 0.08
118 0.1
119 0.11
120 0.12
121 0.14
122 0.17
123 0.2
124 0.21
125 0.25
126 0.27
127 0.3
128 0.34
129 0.37
130 0.38
131 0.39
132 0.42
133 0.39
134 0.39