Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NDU5

Protein Details
Accession A0A2R6NDU5    Localization Confidence High Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-30PPPQGLPAAPRPKRKQVKMACTNCAHydrophilic
54-81CVDGTRKERKKGIKRGPYKRKSKFGSNEBasic
194-218DTVTAAPKSKKKRKVGEDGAPKAKKBasic
NLS Segment(s)
PositionSequence
59-76RKERKKGIKRGPYKRKSK
200-220PKSKKKRKVGEDGAPKAKKAK
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MPYPYPPPQGLPAAPRPKRKQVKMACTNCAGACKRCDDSRPCERCVKYGIADTCVDGTRKERKKGIKRGPYKRKSKFGSNEAFPTASSAPTGEASTEPTTTPAPTYPPMPESYYPYYYPHPGYPTPGHEVPQPNGEAVANGNGHPMPHPYYPLHPAVYPSYPPYSHPGPVAYAPPPAMMPPPPPPPDVNGKADDTVTAAPKSKKKRKVGEDGAPKAKKAKATNGEIANGVGPTAVGSSHTNGTAVNGVNGAADQRHAVSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.67
4 0.72
5 0.8
6 0.8
7 0.81
8 0.8
9 0.84
10 0.85
11 0.84
12 0.79
13 0.72
14 0.67
15 0.57
16 0.55
17 0.47
18 0.41
19 0.37
20 0.37
21 0.38
22 0.38
23 0.45
24 0.44
25 0.48
26 0.55
27 0.57
28 0.56
29 0.61
30 0.59
31 0.55
32 0.53
33 0.49
34 0.41
35 0.43
36 0.41
37 0.35
38 0.34
39 0.31
40 0.28
41 0.26
42 0.23
43 0.16
44 0.2
45 0.27
46 0.34
47 0.39
48 0.44
49 0.53
50 0.63
51 0.73
52 0.78
53 0.79
54 0.82
55 0.87
56 0.91
57 0.91
58 0.91
59 0.88
60 0.87
61 0.82
62 0.82
63 0.79
64 0.77
65 0.75
66 0.67
67 0.62
68 0.55
69 0.49
70 0.39
71 0.34
72 0.25
73 0.17
74 0.14
75 0.11
76 0.1
77 0.1
78 0.1
79 0.08
80 0.07
81 0.11
82 0.12
83 0.12
84 0.11
85 0.12
86 0.12
87 0.12
88 0.13
89 0.1
90 0.11
91 0.12
92 0.13
93 0.13
94 0.14
95 0.16
96 0.18
97 0.19
98 0.22
99 0.25
100 0.26
101 0.26
102 0.27
103 0.27
104 0.26
105 0.27
106 0.23
107 0.22
108 0.19
109 0.23
110 0.23
111 0.24
112 0.26
113 0.25
114 0.24
115 0.24
116 0.27
117 0.23
118 0.24
119 0.21
120 0.16
121 0.16
122 0.15
123 0.11
124 0.08
125 0.1
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.08
132 0.1
133 0.11
134 0.11
135 0.14
136 0.14
137 0.17
138 0.2
139 0.22
140 0.21
141 0.18
142 0.2
143 0.2
144 0.2
145 0.19
146 0.17
147 0.18
148 0.17
149 0.18
150 0.21
151 0.21
152 0.21
153 0.21
154 0.19
155 0.18
156 0.19
157 0.21
158 0.16
159 0.15
160 0.14
161 0.13
162 0.13
163 0.11
164 0.12
165 0.11
166 0.13
167 0.17
168 0.24
169 0.26
170 0.28
171 0.28
172 0.3
173 0.37
174 0.39
175 0.38
176 0.33
177 0.33
178 0.32
179 0.31
180 0.28
181 0.21
182 0.18
183 0.16
184 0.15
185 0.18
186 0.22
187 0.29
188 0.4
189 0.47
190 0.55
191 0.62
192 0.71
193 0.76
194 0.82
195 0.84
196 0.83
197 0.84
198 0.83
199 0.84
200 0.75
201 0.66
202 0.6
203 0.53
204 0.5
205 0.45
206 0.47
207 0.45
208 0.51
209 0.58
210 0.56
211 0.54
212 0.48
213 0.44
214 0.34
215 0.25
216 0.18
217 0.1
218 0.07
219 0.06
220 0.05
221 0.05
222 0.06
223 0.08
224 0.11
225 0.13
226 0.14
227 0.13
228 0.13
229 0.15
230 0.17
231 0.16
232 0.14
233 0.12
234 0.12
235 0.12
236 0.12
237 0.11
238 0.08
239 0.08
240 0.08
241 0.09