Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6S3V0

Protein Details
Accession A0A2R6S3V0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-89VDAATPKKKPRYRKKTQPPTHRPPPAFHydrophilic
113-135VPIGGVRQRKYRRDKMRTGVLSIHydrophilic
NLS Segment(s)
PositionSequence
68-84PKKKPRYRKKTQPPTHR
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSPKQISERDAPKQQLLKSRGLFNNPKFLSMPLSTPKLPKKIHPSPHGFSADGICCPVVSVTVDAATPKKKPRYRKKTQPPTHRPPPAFWRPLQEWAGKSMGYAMGYEGSEAVPIGGVRQRKYRRDKMRTGVLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.56
4 0.56
5 0.51
6 0.56
7 0.54
8 0.56
9 0.61
10 0.54
11 0.6
12 0.52
13 0.51
14 0.43
15 0.4
16 0.37
17 0.29
18 0.3
19 0.24
20 0.28
21 0.28
22 0.33
23 0.37
24 0.4
25 0.41
26 0.43
27 0.49
28 0.53
29 0.61
30 0.63
31 0.65
32 0.6
33 0.65
34 0.61
35 0.51
36 0.42
37 0.37
38 0.29
39 0.22
40 0.19
41 0.12
42 0.09
43 0.09
44 0.08
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.09
54 0.11
55 0.16
56 0.25
57 0.3
58 0.41
59 0.52
60 0.61
61 0.7
62 0.78
63 0.84
64 0.86
65 0.92
66 0.92
67 0.91
68 0.9
69 0.89
70 0.86
71 0.76
72 0.7
73 0.69
74 0.67
75 0.61
76 0.53
77 0.5
78 0.45
79 0.5
80 0.48
81 0.43
82 0.35
83 0.34
84 0.34
85 0.26
86 0.23
87 0.18
88 0.16
89 0.12
90 0.11
91 0.09
92 0.09
93 0.09
94 0.09
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.05
101 0.05
102 0.07
103 0.1
104 0.14
105 0.17
106 0.27
107 0.36
108 0.45
109 0.55
110 0.64
111 0.71
112 0.77
113 0.84
114 0.83
115 0.86