Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NIV8

Protein Details
Accession A0A2R6NIV8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-41GESSSKSKRYRHARKRDGDRKSCISBasic
NLS Segment(s)
PositionSequence
22-32KSKRYRHARKR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MCKLDGWIDEGVIKWHGESSSKSKRYRHARKRDGDRKSCISFDNSGINFEANEEKEETEANVCDEGQIGLRILGEDVLLEPGNTTESGWTWEINELESDDRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.13
5 0.17
6 0.24
7 0.34
8 0.41
9 0.46
10 0.49
11 0.58
12 0.67
13 0.74
14 0.76
15 0.77
16 0.8
17 0.84
18 0.9
19 0.9
20 0.89
21 0.85
22 0.81
23 0.76
24 0.69
25 0.61
26 0.51
27 0.45
28 0.36
29 0.3
30 0.31
31 0.24
32 0.22
33 0.21
34 0.2
35 0.16
36 0.15
37 0.15
38 0.09
39 0.1
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.06
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.11
75 0.12
76 0.12
77 0.12
78 0.16
79 0.16
80 0.16
81 0.17
82 0.15