Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NUR0

Protein Details
Accession A0A2R6NUR0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-99EPYDRSPEQKRRMKRGYEKKRSWMDEBasic
NLS Segment(s)
PositionSequence
83-93KRRMKRGYEKK
Subcellular Location(s) cyto 14.5, cyto_nucl 12, nucl 8.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001547  Glyco_hydro_5  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0071704  P:organic substance metabolic process  
Pfam View protein in Pfam  
PF00150  Cellulase  
Amino Acid Sequences MNEPADPNHTALIEYYDRVHAAIRSVDPNHILFLDGNTFSTDFSRFPDDAGTRWPNSAFAIHDYSIYGFPKSPEPYDRSPEQKRRMKRGYEKKRSWMDERGFCVWNGEWGPVYARKEYEGEETDEINQRRYNVLKDQLDLYDNDRLSWSIWLYKDIGFQGMVHVSPSTSYMKLLTDSGFLAKKYRLAVDSWGATDTAVKHVYDPIINLIKQEVPKEEDRQLYPYPIWRVEERVARLARANLLGEFLVMEWAEHFKGMDEAELEDLAKSFLFENCLKREGLNKVLTEYAAQAASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.18
5 0.18
6 0.19
7 0.15
8 0.16
9 0.19
10 0.2
11 0.24
12 0.25
13 0.27
14 0.28
15 0.28
16 0.26
17 0.22
18 0.2
19 0.15
20 0.15
21 0.17
22 0.15
23 0.15
24 0.15
25 0.15
26 0.14
27 0.15
28 0.15
29 0.11
30 0.14
31 0.19
32 0.18
33 0.18
34 0.24
35 0.24
36 0.24
37 0.31
38 0.33
39 0.28
40 0.3
41 0.3
42 0.24
43 0.24
44 0.25
45 0.18
46 0.17
47 0.2
48 0.19
49 0.19
50 0.19
51 0.19
52 0.2
53 0.19
54 0.16
55 0.13
56 0.14
57 0.2
58 0.22
59 0.23
60 0.26
61 0.31
62 0.35
63 0.4
64 0.44
65 0.46
66 0.53
67 0.6
68 0.65
69 0.67
70 0.7
71 0.75
72 0.78
73 0.79
74 0.8
75 0.82
76 0.83
77 0.86
78 0.84
79 0.83
80 0.83
81 0.79
82 0.73
83 0.71
84 0.67
85 0.62
86 0.6
87 0.55
88 0.47
89 0.42
90 0.39
91 0.29
92 0.26
93 0.2
94 0.16
95 0.12
96 0.12
97 0.14
98 0.16
99 0.18
100 0.16
101 0.15
102 0.16
103 0.17
104 0.18
105 0.2
106 0.18
107 0.19
108 0.18
109 0.19
110 0.19
111 0.25
112 0.23
113 0.21
114 0.2
115 0.18
116 0.19
117 0.2
118 0.21
119 0.2
120 0.27
121 0.26
122 0.26
123 0.26
124 0.25
125 0.24
126 0.22
127 0.19
128 0.17
129 0.16
130 0.15
131 0.14
132 0.13
133 0.13
134 0.13
135 0.11
136 0.1
137 0.1
138 0.11
139 0.12
140 0.13
141 0.14
142 0.13
143 0.13
144 0.1
145 0.09
146 0.09
147 0.09
148 0.08
149 0.06
150 0.06
151 0.05
152 0.05
153 0.08
154 0.09
155 0.08
156 0.09
157 0.09
158 0.1
159 0.11
160 0.11
161 0.1
162 0.09
163 0.09
164 0.11
165 0.12
166 0.11
167 0.13
168 0.12
169 0.14
170 0.14
171 0.16
172 0.15
173 0.14
174 0.17
175 0.18
176 0.19
177 0.17
178 0.16
179 0.14
180 0.13
181 0.13
182 0.11
183 0.12
184 0.12
185 0.11
186 0.11
187 0.13
188 0.14
189 0.13
190 0.13
191 0.15
192 0.18
193 0.18
194 0.17
195 0.17
196 0.19
197 0.2
198 0.21
199 0.19
200 0.2
201 0.24
202 0.28
203 0.31
204 0.33
205 0.33
206 0.36
207 0.35
208 0.33
209 0.31
210 0.33
211 0.32
212 0.3
213 0.32
214 0.28
215 0.31
216 0.33
217 0.39
218 0.36
219 0.39
220 0.38
221 0.36
222 0.37
223 0.34
224 0.31
225 0.27
226 0.25
227 0.17
228 0.17
229 0.16
230 0.13
231 0.11
232 0.09
233 0.08
234 0.07
235 0.06
236 0.06
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.1
243 0.1
244 0.11
245 0.09
246 0.1
247 0.11
248 0.12
249 0.11
250 0.1
251 0.1
252 0.09
253 0.08
254 0.07
255 0.07
256 0.08
257 0.13
258 0.17
259 0.24
260 0.27
261 0.3
262 0.3
263 0.3
264 0.36
265 0.37
266 0.41
267 0.41
268 0.37
269 0.38
270 0.39
271 0.38
272 0.32
273 0.27
274 0.21