Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NRL1

Protein Details
Accession A0A2R6NRL1    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-92EEKPPQTRKREIKPLPCRRNAQHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, cyto 6.5, cyto_nucl 5, mito 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
PROSITE View protein in PROSITE  
PS51194  HELICASE_CTER  
Amino Acid Sequences MSHVLQLFHDGSIKILCAFPKGIVGLEVDDIRRVVQFLVPESLREWIRRCGYAGRDGKPSTAILFAEPFEEEKPPQTRKREIKPLPCRRNAQTGQGFAAMHAPSDSMGVRQENKEESSVAATSLIVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.13
5 0.14
6 0.13
7 0.15
8 0.15
9 0.14
10 0.13
11 0.13
12 0.11
13 0.12
14 0.13
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.08
22 0.08
23 0.09
24 0.11
25 0.15
26 0.14
27 0.15
28 0.15
29 0.18
30 0.18
31 0.19
32 0.2
33 0.22
34 0.25
35 0.25
36 0.26
37 0.26
38 0.28
39 0.35
40 0.37
41 0.33
42 0.36
43 0.35
44 0.34
45 0.31
46 0.28
47 0.2
48 0.16
49 0.13
50 0.09
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.07
57 0.08
58 0.08
59 0.12
60 0.17
61 0.23
62 0.29
63 0.34
64 0.43
65 0.5
66 0.58
67 0.64
68 0.67
69 0.72
70 0.77
71 0.83
72 0.82
73 0.82
74 0.78
75 0.71
76 0.73
77 0.65
78 0.63
79 0.58
80 0.51
81 0.45
82 0.42
83 0.38
84 0.28
85 0.3
86 0.21
87 0.15
88 0.13
89 0.11
90 0.09
91 0.1
92 0.11
93 0.07
94 0.1
95 0.14
96 0.17
97 0.19
98 0.22
99 0.25
100 0.26
101 0.27
102 0.25
103 0.22
104 0.23
105 0.21
106 0.18
107 0.15