Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NP29

Protein Details
Accession A0A2R6NP29    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
355-375VMSAKERYLARKRRKLEEADPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018612  NSRP1_N  
Gene Ontology GO:0000381  P:regulation of alternative mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF09745  NSRP1_N  
Amino Acid Sequences MKVSFSLANSKAKAAKPVGEAPTLKRPVTFASLEDDDPVDAATTSGSSKAPANKQLVAQNMEMSKTTKKRIEQEMKVDATVFEYDEVWDKMQEAKLRQKEVKEVDAKERKPKYINNLLVSAATRRIDYLRAEEKMIQREREMEGDEFADKEAFVTQAYKDQMAELRRAEEEEKKREELEKKNKGIGTGMAHFYKKLLEESEQKHEETVAATTKQKPIVGPQGPIPNLTITKPADFTPKSDVELARVARDQGKDVELNDDNQIVDKRELLSAGLNLSAPNTRRLGLQLSKKDSEEPVQVHRAVGTAASRKEINERRAREITKQMEEERERLLKEREREEQESINRIVSKRNTEEDVMSAKERYLARKRRKLEEADPASEDPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.42
4 0.49
5 0.48
6 0.48
7 0.48
8 0.46
9 0.53
10 0.51
11 0.46
12 0.39
13 0.37
14 0.34
15 0.38
16 0.34
17 0.25
18 0.27
19 0.29
20 0.29
21 0.28
22 0.25
23 0.19
24 0.18
25 0.16
26 0.1
27 0.07
28 0.07
29 0.06
30 0.06
31 0.07
32 0.08
33 0.08
34 0.09
35 0.14
36 0.21
37 0.27
38 0.34
39 0.38
40 0.39
41 0.43
42 0.46
43 0.48
44 0.44
45 0.39
46 0.36
47 0.32
48 0.31
49 0.28
50 0.25
51 0.27
52 0.29
53 0.35
54 0.37
55 0.41
56 0.48
57 0.58
58 0.66
59 0.65
60 0.68
61 0.7
62 0.65
63 0.6
64 0.52
65 0.41
66 0.33
67 0.26
68 0.18
69 0.11
70 0.09
71 0.1
72 0.13
73 0.14
74 0.12
75 0.12
76 0.12
77 0.15
78 0.19
79 0.23
80 0.25
81 0.33
82 0.39
83 0.45
84 0.48
85 0.47
86 0.51
87 0.51
88 0.54
89 0.51
90 0.48
91 0.52
92 0.57
93 0.58
94 0.59
95 0.59
96 0.55
97 0.54
98 0.55
99 0.54
100 0.55
101 0.59
102 0.52
103 0.5
104 0.46
105 0.42
106 0.38
107 0.3
108 0.23
109 0.16
110 0.13
111 0.13
112 0.13
113 0.15
114 0.15
115 0.2
116 0.23
117 0.24
118 0.25
119 0.29
120 0.32
121 0.38
122 0.41
123 0.35
124 0.3
125 0.32
126 0.32
127 0.29
128 0.27
129 0.19
130 0.16
131 0.16
132 0.16
133 0.13
134 0.12
135 0.1
136 0.07
137 0.06
138 0.06
139 0.05
140 0.05
141 0.06
142 0.06
143 0.11
144 0.12
145 0.12
146 0.12
147 0.12
148 0.16
149 0.17
150 0.19
151 0.15
152 0.16
153 0.15
154 0.17
155 0.18
156 0.22
157 0.27
158 0.31
159 0.34
160 0.33
161 0.34
162 0.38
163 0.44
164 0.46
165 0.5
166 0.53
167 0.52
168 0.55
169 0.55
170 0.49
171 0.43
172 0.35
173 0.28
174 0.21
175 0.21
176 0.18
177 0.17
178 0.17
179 0.16
180 0.14
181 0.12
182 0.1
183 0.09
184 0.11
185 0.18
186 0.22
187 0.29
188 0.3
189 0.29
190 0.28
191 0.27
192 0.24
193 0.18
194 0.16
195 0.1
196 0.11
197 0.13
198 0.15
199 0.18
200 0.19
201 0.19
202 0.18
203 0.2
204 0.28
205 0.28
206 0.26
207 0.28
208 0.32
209 0.32
210 0.32
211 0.29
212 0.21
213 0.19
214 0.19
215 0.2
216 0.15
217 0.15
218 0.16
219 0.16
220 0.21
221 0.21
222 0.22
223 0.24
224 0.24
225 0.25
226 0.27
227 0.26
228 0.21
229 0.26
230 0.25
231 0.2
232 0.2
233 0.19
234 0.2
235 0.21
236 0.2
237 0.17
238 0.19
239 0.18
240 0.18
241 0.22
242 0.19
243 0.2
244 0.19
245 0.18
246 0.15
247 0.16
248 0.17
249 0.14
250 0.13
251 0.13
252 0.13
253 0.13
254 0.13
255 0.12
256 0.12
257 0.1
258 0.1
259 0.1
260 0.09
261 0.08
262 0.09
263 0.12
264 0.12
265 0.14
266 0.15
267 0.15
268 0.16
269 0.18
270 0.24
271 0.27
272 0.35
273 0.4
274 0.45
275 0.47
276 0.47
277 0.48
278 0.43
279 0.4
280 0.37
281 0.32
282 0.31
283 0.34
284 0.34
285 0.31
286 0.29
287 0.25
288 0.19
289 0.18
290 0.16
291 0.17
292 0.17
293 0.2
294 0.2
295 0.21
296 0.3
297 0.37
298 0.42
299 0.46
300 0.49
301 0.55
302 0.62
303 0.64
304 0.61
305 0.63
306 0.61
307 0.58
308 0.59
309 0.54
310 0.56
311 0.56
312 0.52
313 0.48
314 0.45
315 0.39
316 0.39
317 0.43
318 0.41
319 0.45
320 0.49
321 0.52
322 0.56
323 0.59
324 0.58
325 0.58
326 0.57
327 0.56
328 0.51
329 0.46
330 0.42
331 0.39
332 0.43
333 0.41
334 0.44
335 0.43
336 0.47
337 0.46
338 0.45
339 0.46
340 0.42
341 0.4
342 0.34
343 0.31
344 0.27
345 0.23
346 0.27
347 0.27
348 0.32
349 0.39
350 0.46
351 0.56
352 0.65
353 0.71
354 0.75
355 0.81
356 0.81
357 0.79
358 0.79
359 0.76
360 0.71
361 0.69