Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NV45

Protein Details
Accession A0A2R6NV45    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKVRWTKAFRKAAGKEBasic
71-95MAASREKLRAHRKKKAEKSSVKLVEHydrophilic
NLS Segment(s)
PositionSequence
6-9RKVR
53-88KRIAEIKHKREHVFWKHRMAASREKLRAHRKKKAEK
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKVRWTKAFRKAAGKEMTIDSTIDFEKRRNVPVRYDRELIQTTVKAMKRIAEIKHKREHVFWKHRMAASREKLRAHRKKKAEKSSVKLVEPMAMETTETEPIREKIRVSAKSRSALVPGEGRSMGMDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.76
4 0.74
5 0.69
6 0.59
7 0.52
8 0.45
9 0.42
10 0.33
11 0.3
12 0.21
13 0.17
14 0.17
15 0.16
16 0.14
17 0.14
18 0.21
19 0.23
20 0.3
21 0.35
22 0.37
23 0.44
24 0.53
25 0.59
26 0.57
27 0.57
28 0.51
29 0.49
30 0.48
31 0.4
32 0.33
33 0.26
34 0.22
35 0.26
36 0.26
37 0.22
38 0.2
39 0.21
40 0.22
41 0.27
42 0.29
43 0.33
44 0.39
45 0.44
46 0.51
47 0.53
48 0.5
49 0.5
50 0.55
51 0.54
52 0.57
53 0.56
54 0.55
55 0.55
56 0.55
57 0.55
58 0.5
59 0.49
60 0.47
61 0.49
62 0.46
63 0.46
64 0.51
65 0.58
66 0.64
67 0.63
68 0.65
69 0.67
70 0.74
71 0.81
72 0.85
73 0.84
74 0.82
75 0.8
76 0.82
77 0.77
78 0.67
79 0.59
80 0.49
81 0.42
82 0.34
83 0.29
84 0.19
85 0.14
86 0.13
87 0.12
88 0.14
89 0.15
90 0.15
91 0.14
92 0.16
93 0.18
94 0.22
95 0.22
96 0.21
97 0.24
98 0.33
99 0.41
100 0.43
101 0.5
102 0.52
103 0.55
104 0.57
105 0.5
106 0.44
107 0.38
108 0.37
109 0.33
110 0.29
111 0.28
112 0.25
113 0.24
114 0.22