Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YCJ7

Protein Details
Accession G8YCJ7    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-40SAAIGKKRASRQKSAPKTRSSHydrophilic
74-95ITTKSLSKKRAKKISRNQKYIAHydrophilic
NLS Segment(s)
PositionSequence
19-36HSAAIGKKRASRQKSAPK
81-87KKRAKKI
Subcellular Location(s) nucl 13, mito 10, cyto_nucl 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MPSRNSVNKPKDKILRNSHSAAIGKKRASRQKSAPKTRSSTFRYNENSNVKPSPTESNSLALYSGRPIDATGGITTKSLSKKRAKKISRNQKYIAQRNEQLGIDLKAKEESMEVEDENPAENEDSSKSSSVDAVRKALWSVVKDTTAGVLQIAAEHGEGTTLGIQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.74
4 0.71
5 0.64
6 0.6
7 0.55
8 0.51
9 0.48
10 0.46
11 0.44
12 0.47
13 0.53
14 0.57
15 0.6
16 0.63
17 0.65
18 0.7
19 0.77
20 0.82
21 0.8
22 0.78
23 0.78
24 0.75
25 0.73
26 0.69
27 0.67
28 0.59
29 0.61
30 0.59
31 0.57
32 0.6
33 0.58
34 0.53
35 0.49
36 0.48
37 0.39
38 0.34
39 0.33
40 0.32
41 0.27
42 0.28
43 0.24
44 0.25
45 0.25
46 0.24
47 0.22
48 0.15
49 0.13
50 0.1
51 0.1
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.1
64 0.15
65 0.17
66 0.23
67 0.32
68 0.4
69 0.49
70 0.59
71 0.63
72 0.69
73 0.77
74 0.81
75 0.83
76 0.8
77 0.74
78 0.72
79 0.74
80 0.72
81 0.67
82 0.6
83 0.53
84 0.49
85 0.49
86 0.41
87 0.33
88 0.26
89 0.22
90 0.19
91 0.16
92 0.15
93 0.13
94 0.13
95 0.12
96 0.1
97 0.09
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.11
105 0.1
106 0.08
107 0.07
108 0.07
109 0.08
110 0.09
111 0.11
112 0.12
113 0.13
114 0.13
115 0.13
116 0.16
117 0.19
118 0.22
119 0.22
120 0.23
121 0.23
122 0.23
123 0.23
124 0.24
125 0.23
126 0.2
127 0.22
128 0.22
129 0.22
130 0.22
131 0.22
132 0.2
133 0.17
134 0.15
135 0.11
136 0.08
137 0.07
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.07