Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NIW8

Protein Details
Accession A0A2R6NIW8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-32GSSSSKVKDDKKNKSSKVQKQIAQHydrophilic
NLS Segment(s)
PositionSequence
47-58LEKEKEKAMRDK
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MPPKKQVGGSSSSKVKDDKKNKSSKVQKQIAQIEKQQAQAGKSRAALEKEKEKAMRDKAKLDDEKRMKEEAALLKPVQMQKVPFGVDPKTLLCVFYKAGHCDKGNKCKFSHDMNVGRKVEKKNLYEDNREEKLKGAVAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.52
4 0.56
5 0.61
6 0.65
7 0.73
8 0.76
9 0.82
10 0.84
11 0.84
12 0.85
13 0.82
14 0.77
15 0.75
16 0.79
17 0.76
18 0.7
19 0.64
20 0.61
21 0.56
22 0.52
23 0.46
24 0.39
25 0.33
26 0.35
27 0.32
28 0.27
29 0.26
30 0.27
31 0.27
32 0.29
33 0.32
34 0.29
35 0.35
36 0.35
37 0.37
38 0.36
39 0.36
40 0.39
41 0.44
42 0.48
43 0.43
44 0.46
45 0.45
46 0.51
47 0.55
48 0.5
49 0.51
50 0.47
51 0.49
52 0.46
53 0.43
54 0.35
55 0.29
56 0.31
57 0.27
58 0.24
59 0.22
60 0.19
61 0.2
62 0.22
63 0.23
64 0.2
65 0.16
66 0.14
67 0.14
68 0.16
69 0.16
70 0.15
71 0.16
72 0.16
73 0.16
74 0.17
75 0.15
76 0.16
77 0.15
78 0.15
79 0.13
80 0.13
81 0.13
82 0.17
83 0.2
84 0.21
85 0.24
86 0.27
87 0.28
88 0.36
89 0.42
90 0.48
91 0.52
92 0.52
93 0.5
94 0.52
95 0.55
96 0.53
97 0.54
98 0.52
99 0.54
100 0.57
101 0.65
102 0.6
103 0.59
104 0.59
105 0.55
106 0.55
107 0.53
108 0.5
109 0.49
110 0.57
111 0.61
112 0.63
113 0.65
114 0.65
115 0.62
116 0.61
117 0.54
118 0.46
119 0.43
120 0.37