Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6RZN4

Protein Details
Accession A0A2R6RZN4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ESSTSQKKPSNASKPRKRFVGSHydrophilic
NLS Segment(s)
PositionSequence
20-25SKPRKR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016435  DPH1/DPH2  
IPR042263  DPH1/DPH2_1  
Gene Ontology GO:0090560  F:2-(3-amino-3-carboxypropyl)histidine synthase activity  
GO:0017183  P:peptidyl-diphthamide biosynthetic process from peptidyl-histidine  
Amino Acid Sequences MTNDAMGESSTSQKKPSNASKPRKRFVGSKSATPSKPGLASVVANQIPPEILQDTQLNSAIKQLPSNYSFEIHKTIHHIRKNNSKMVALQMPEGLQMFACTITDIIERADN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.47
4 0.52
5 0.58
6 0.68
7 0.75
8 0.81
9 0.83
10 0.82
11 0.75
12 0.71
13 0.67
14 0.67
15 0.59
16 0.57
17 0.58
18 0.59
19 0.55
20 0.51
21 0.46
22 0.37
23 0.35
24 0.28
25 0.21
26 0.15
27 0.16
28 0.14
29 0.18
30 0.16
31 0.15
32 0.14
33 0.13
34 0.12
35 0.11
36 0.11
37 0.06
38 0.06
39 0.08
40 0.09
41 0.1
42 0.1
43 0.13
44 0.12
45 0.11
46 0.13
47 0.15
48 0.14
49 0.14
50 0.14
51 0.16
52 0.17
53 0.19
54 0.17
55 0.16
56 0.17
57 0.17
58 0.21
59 0.18
60 0.17
61 0.22
62 0.3
63 0.36
64 0.41
65 0.46
66 0.48
67 0.59
68 0.63
69 0.63
70 0.57
71 0.51
72 0.46
73 0.46
74 0.44
75 0.34
76 0.3
77 0.25
78 0.22
79 0.21
80 0.2
81 0.14
82 0.09
83 0.08
84 0.08
85 0.07
86 0.07
87 0.07
88 0.06
89 0.08
90 0.09
91 0.09