Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y4G5

Protein Details
Accession G8Y4G5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-162SDLVSWKKAAKKFKIRRFSNDSSHydrophilic
NLS Segment(s)
PositionSequence
150-151KK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCVYREEVYRARNMIYELLEDSYREYIRSVRGRRSSSVAPSARRVSDAVPPDALWGGSAAAANRTLSPTPPAEFSLRPVANAGACESSYSLTSRISVSQAITSSDEDLEKSARQRENSASTMTSSRGSSISSIMDSFKNSDLVSWKKAAKKFKIRRFSNDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.22
4 0.19
5 0.19
6 0.18
7 0.17
8 0.17
9 0.18
10 0.17
11 0.15
12 0.15
13 0.15
14 0.23
15 0.33
16 0.36
17 0.41
18 0.48
19 0.52
20 0.53
21 0.57
22 0.53
23 0.49
24 0.53
25 0.49
26 0.44
27 0.46
28 0.47
29 0.41
30 0.38
31 0.34
32 0.26
33 0.28
34 0.28
35 0.25
36 0.22
37 0.21
38 0.2
39 0.2
40 0.17
41 0.11
42 0.07
43 0.06
44 0.05
45 0.06
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.11
55 0.12
56 0.12
57 0.13
58 0.15
59 0.16
60 0.15
61 0.17
62 0.23
63 0.22
64 0.21
65 0.2
66 0.19
67 0.16
68 0.17
69 0.15
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.09
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.11
88 0.12
89 0.12
90 0.12
91 0.11
92 0.11
93 0.09
94 0.1
95 0.1
96 0.1
97 0.13
98 0.19
99 0.22
100 0.23
101 0.26
102 0.31
103 0.35
104 0.35
105 0.35
106 0.29
107 0.27
108 0.27
109 0.25
110 0.22
111 0.16
112 0.15
113 0.14
114 0.14
115 0.13
116 0.13
117 0.13
118 0.12
119 0.12
120 0.13
121 0.14
122 0.14
123 0.16
124 0.16
125 0.16
126 0.15
127 0.16
128 0.22
129 0.25
130 0.28
131 0.3
132 0.34
133 0.4
134 0.46
135 0.54
136 0.57
137 0.64
138 0.71
139 0.76
140 0.82
141 0.81
142 0.85