Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NWM3

Protein Details
Accession A0A2R6NWM3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-92NQQAEERRHHRRERRLAQQPVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036727  Olfactory_marker_sf  
Gene Ontology GO:0007165  P:signal transduction  
Amino Acid Sequences MTRTSSYHLARQAQLARTMRLRLTQTPEQREAARRQEEAEIRWQHHLHQLDLEAQREALYQEWLVGLRRINQQAEERRHHRRERRLAQQPVIVDPEFTILRSGRKVRRMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.41
4 0.4
5 0.41
6 0.36
7 0.35
8 0.36
9 0.33
10 0.38
11 0.43
12 0.48
13 0.52
14 0.54
15 0.51
16 0.5
17 0.51
18 0.49
19 0.49
20 0.45
21 0.39
22 0.37
23 0.41
24 0.39
25 0.35
26 0.39
27 0.33
28 0.31
29 0.35
30 0.33
31 0.29
32 0.33
33 0.32
34 0.24
35 0.21
36 0.2
37 0.22
38 0.23
39 0.22
40 0.16
41 0.14
42 0.14
43 0.13
44 0.12
45 0.07
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.12
55 0.17
56 0.19
57 0.2
58 0.22
59 0.29
60 0.37
61 0.43
62 0.47
63 0.48
64 0.55
65 0.63
66 0.69
67 0.71
68 0.72
69 0.76
70 0.78
71 0.82
72 0.83
73 0.83
74 0.78
75 0.72
76 0.63
77 0.55
78 0.5
79 0.4
80 0.29
81 0.22
82 0.21
83 0.18
84 0.17
85 0.17
86 0.13
87 0.17
88 0.24
89 0.32
90 0.36