Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NVW6

Protein Details
Accession A0A2R6NVW6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-46VNPHAKLSNPQVKKNQKNTRNSTAASKSKLKPKPRPRYPPKDSQAHydrophilic
NLS Segment(s)
PositionSequence
25-40AASKSKLKPKPRPRYP
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVNPHAKLSNPQVKKNQKNTRNSTAASKSKLKPKPRPRYPPKDSQAQEHPERSSPGPSPVHTSSQIAHTTTQMHSDSPSPTPPTRKQIRRAVQDEDHNIDPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.81
4 0.79
5 0.85
6 0.86
7 0.84
8 0.79
9 0.7
10 0.67
11 0.65
12 0.62
13 0.57
14 0.57
15 0.52
16 0.57
17 0.63
18 0.65
19 0.67
20 0.72
21 0.78
22 0.81
23 0.87
24 0.88
25 0.91
26 0.87
27 0.87
28 0.8
29 0.78
30 0.69
31 0.63
32 0.61
33 0.56
34 0.53
35 0.45
36 0.42
37 0.34
38 0.35
39 0.3
40 0.25
41 0.2
42 0.22
43 0.21
44 0.21
45 0.26
46 0.26
47 0.28
48 0.26
49 0.26
50 0.21
51 0.24
52 0.25
53 0.2
54 0.18
55 0.16
56 0.17
57 0.17
58 0.2
59 0.16
60 0.15
61 0.15
62 0.17
63 0.18
64 0.18
65 0.22
66 0.23
67 0.26
68 0.34
69 0.39
70 0.46
71 0.54
72 0.6
73 0.65
74 0.71
75 0.77
76 0.79
77 0.77
78 0.76
79 0.72
80 0.73
81 0.7
82 0.64