Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YMT2

Protein Details
Accession G8YMT2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
280-304TEAGPKGKSDREKKMKIKAESKKTLBasic
NLS Segment(s)
PositionSequence
284-302PKGKSDREKKMKIKAESKK
Subcellular Location(s) nucl 6.5cyto_nucl 6.5, plas 6, cyto 5.5, mito 3, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006694  Fatty_acid_hydroxylase  
Gene Ontology GO:0016020  C:membrane  
GO:0005506  F:iron ion binding  
GO:0016491  F:oxidoreductase activity  
GO:0044255  P:cellular lipid metabolic process  
GO:0008610  P:lipid biosynthetic process  
Pfam View protein in Pfam  
PF04116  FA_hydroxylase  
Amino Acid Sequences MVSLVYHDYSGFSNSTTFGEAYQNFSQLTDLNWVEKVWASYYYYMNNDLFATGLLIFVLHEFMYFGRCLPWIIIDRIPYFRKYKIQDAKLPSSKEQWECFKSVLTSHFLVEAFPIWFFHPVCQRIGISFEVPFPSWTTIAFHLSVFFVLEDAWHYWFHRGLHYGVFYKYIHKQHHRYAAPFGLTAEYAHPIEVMLLGFGTVGIPIVWCLITKNLHLFTVCSWITLRLFQAVDSHSGYEFPWSLHNFLPFWAGADHHDEHHHYFIGSYSSSFRWWDYILDTEAGPKGKSDREKKMKIKAESKKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.14
5 0.13
6 0.19
7 0.19
8 0.25
9 0.26
10 0.26
11 0.24
12 0.24
13 0.24
14 0.18
15 0.18
16 0.18
17 0.17
18 0.17
19 0.18
20 0.17
21 0.17
22 0.19
23 0.18
24 0.14
25 0.15
26 0.16
27 0.19
28 0.21
29 0.23
30 0.24
31 0.26
32 0.24
33 0.23
34 0.21
35 0.17
36 0.15
37 0.11
38 0.11
39 0.07
40 0.07
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.04
47 0.04
48 0.05
49 0.05
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.14
58 0.15
59 0.18
60 0.2
61 0.23
62 0.25
63 0.29
64 0.31
65 0.31
66 0.3
67 0.31
68 0.37
69 0.38
70 0.46
71 0.5
72 0.54
73 0.58
74 0.62
75 0.68
76 0.66
77 0.65
78 0.57
79 0.53
80 0.52
81 0.49
82 0.46
83 0.43
84 0.4
85 0.39
86 0.37
87 0.33
88 0.28
89 0.26
90 0.24
91 0.2
92 0.18
93 0.17
94 0.18
95 0.16
96 0.15
97 0.13
98 0.12
99 0.09
100 0.08
101 0.08
102 0.07
103 0.1
104 0.1
105 0.13
106 0.18
107 0.19
108 0.2
109 0.21
110 0.2
111 0.18
112 0.2
113 0.18
114 0.13
115 0.12
116 0.12
117 0.12
118 0.12
119 0.12
120 0.11
121 0.11
122 0.1
123 0.1
124 0.11
125 0.11
126 0.12
127 0.12
128 0.11
129 0.1
130 0.1
131 0.1
132 0.08
133 0.06
134 0.05
135 0.04
136 0.04
137 0.05
138 0.05
139 0.07
140 0.07
141 0.07
142 0.08
143 0.11
144 0.11
145 0.12
146 0.13
147 0.13
148 0.14
149 0.16
150 0.17
151 0.15
152 0.17
153 0.15
154 0.16
155 0.22
156 0.26
157 0.31
158 0.37
159 0.41
160 0.45
161 0.55
162 0.54
163 0.5
164 0.48
165 0.44
166 0.38
167 0.33
168 0.27
169 0.18
170 0.15
171 0.14
172 0.11
173 0.09
174 0.09
175 0.08
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.04
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.02
188 0.03
189 0.02
190 0.03
191 0.03
192 0.04
193 0.04
194 0.04
195 0.05
196 0.08
197 0.1
198 0.11
199 0.15
200 0.16
201 0.17
202 0.17
203 0.17
204 0.15
205 0.2
206 0.19
207 0.16
208 0.15
209 0.17
210 0.17
211 0.18
212 0.18
213 0.14
214 0.15
215 0.14
216 0.17
217 0.16
218 0.18
219 0.17
220 0.18
221 0.14
222 0.15
223 0.15
224 0.14
225 0.13
226 0.11
227 0.16
228 0.17
229 0.19
230 0.21
231 0.23
232 0.2
233 0.2
234 0.22
235 0.16
236 0.16
237 0.14
238 0.13
239 0.12
240 0.18
241 0.18
242 0.18
243 0.2
244 0.21
245 0.24
246 0.25
247 0.24
248 0.18
249 0.18
250 0.17
251 0.18
252 0.15
253 0.14
254 0.14
255 0.15
256 0.17
257 0.18
258 0.17
259 0.17
260 0.17
261 0.18
262 0.18
263 0.21
264 0.21
265 0.21
266 0.2
267 0.21
268 0.23
269 0.23
270 0.2
271 0.17
272 0.19
273 0.26
274 0.36
275 0.42
276 0.5
277 0.59
278 0.69
279 0.76
280 0.82
281 0.84
282 0.84
283 0.86
284 0.85