Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6QIQ6

Protein Details
Accession A0A2R6QIQ6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
14-33LDQVVGKRREKPNRDRHGKGBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
Amino Acid Sequences MTHIRRQEMGSVTLDQVVGKRREKPNRDRHGKGLDYCVVEVIRRMRNKGERPGCALQSENGHVVRNDNDKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.17
3 0.16
4 0.2
5 0.23
6 0.23
7 0.31
8 0.39
9 0.49
10 0.58
11 0.66
12 0.7
13 0.76
14 0.81
15 0.77
16 0.74
17 0.72
18 0.67
19 0.58
20 0.51
21 0.44
22 0.36
23 0.32
24 0.26
25 0.18
26 0.15
27 0.16
28 0.16
29 0.19
30 0.2
31 0.22
32 0.28
33 0.36
34 0.43
35 0.51
36 0.54
37 0.51
38 0.56
39 0.59
40 0.54
41 0.48
42 0.43
43 0.35
44 0.32
45 0.32
46 0.28
47 0.24
48 0.25
49 0.23
50 0.24
51 0.27