Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6RZJ3

Protein Details
Accession A0A2R6RZJ3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
227-260RNGDREKERERPKERDRDKDRDRDRDRTKRNGAYBasic
NLS Segment(s)
PositionSequence
192-257RASIDRKVPRVKMETDEGQRARPRSPERDREKEKGRNGDREKERERPKERDRDKDRDRDRDRTKRN
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033757  WTAP  
Gene Ontology GO:0005634  C:nucleus  
GO:0080009  P:mRNA methylation  
GO:0006397  P:mRNA processing  
GO:0000381  P:regulation of alternative mRNA splicing, via spliceosome  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF17098  Wtap  
Amino Acid Sequences MDLPTSREIELETLLRQRDAQVADLTDEVTHLRQYLTNQPSPSVTDQISLPPPLVSLLLPHINDRSSTATTSSNTVTAALTQRVKVLQEENDELYELLKSGETGRLKEDVRSLRRVVQKLEGALRESHQVIANLSTSSNGSAKPLPTAPRAHKKPRLSETQSTPSSVPLHVKENRSQSSSTRRNDSRERSPRASIDRKVPRVKMETDEGQRARPRSPERDREKEKGRNGDREKERERPKERDRDKDRDRDRDRTKRNGAYGNSSGSGSGQAGGGGSRRGRRISNANSYGSGDRTLAERMGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.22
5 0.25
6 0.25
7 0.25
8 0.23
9 0.23
10 0.23
11 0.23
12 0.22
13 0.16
14 0.15
15 0.13
16 0.11
17 0.1
18 0.1
19 0.1
20 0.12
21 0.16
22 0.25
23 0.31
24 0.35
25 0.35
26 0.36
27 0.36
28 0.39
29 0.38
30 0.32
31 0.25
32 0.22
33 0.22
34 0.25
35 0.26
36 0.22
37 0.2
38 0.16
39 0.15
40 0.14
41 0.15
42 0.1
43 0.08
44 0.12
45 0.16
46 0.16
47 0.18
48 0.18
49 0.18
50 0.19
51 0.2
52 0.2
53 0.17
54 0.18
55 0.19
56 0.2
57 0.2
58 0.22
59 0.21
60 0.17
61 0.15
62 0.15
63 0.13
64 0.13
65 0.15
66 0.16
67 0.17
68 0.16
69 0.18
70 0.18
71 0.19
72 0.18
73 0.19
74 0.19
75 0.21
76 0.23
77 0.23
78 0.22
79 0.22
80 0.2
81 0.17
82 0.13
83 0.09
84 0.07
85 0.05
86 0.05
87 0.06
88 0.12
89 0.13
90 0.14
91 0.15
92 0.19
93 0.2
94 0.21
95 0.26
96 0.29
97 0.32
98 0.36
99 0.35
100 0.38
101 0.44
102 0.45
103 0.41
104 0.38
105 0.36
106 0.34
107 0.36
108 0.3
109 0.25
110 0.24
111 0.22
112 0.19
113 0.17
114 0.16
115 0.14
116 0.13
117 0.11
118 0.12
119 0.12
120 0.1
121 0.09
122 0.08
123 0.07
124 0.08
125 0.08
126 0.07
127 0.08
128 0.1
129 0.1
130 0.11
131 0.13
132 0.15
133 0.18
134 0.23
135 0.27
136 0.36
137 0.42
138 0.49
139 0.54
140 0.57
141 0.61
142 0.62
143 0.65
144 0.61
145 0.61
146 0.59
147 0.59
148 0.55
149 0.48
150 0.43
151 0.36
152 0.3
153 0.25
154 0.22
155 0.16
156 0.21
157 0.24
158 0.27
159 0.3
160 0.36
161 0.37
162 0.37
163 0.36
164 0.34
165 0.4
166 0.46
167 0.44
168 0.45
169 0.45
170 0.49
171 0.56
172 0.59
173 0.59
174 0.6
175 0.65
176 0.61
177 0.61
178 0.6
179 0.6
180 0.61
181 0.53
182 0.54
183 0.55
184 0.59
185 0.62
186 0.59
187 0.56
188 0.53
189 0.52
190 0.46
191 0.42
192 0.41
193 0.39
194 0.45
195 0.4
196 0.41
197 0.42
198 0.4
199 0.37
200 0.38
201 0.41
202 0.43
203 0.52
204 0.57
205 0.62
206 0.71
207 0.76
208 0.76
209 0.79
210 0.78
211 0.76
212 0.76
213 0.74
214 0.74
215 0.73
216 0.75
217 0.73
218 0.73
219 0.71
220 0.7
221 0.74
222 0.74
223 0.75
224 0.75
225 0.77
226 0.78
227 0.8
228 0.82
229 0.81
230 0.81
231 0.82
232 0.83
233 0.82
234 0.82
235 0.81
236 0.81
237 0.83
238 0.83
239 0.82
240 0.82
241 0.82
242 0.79
243 0.78
244 0.76
245 0.68
246 0.66
247 0.61
248 0.54
249 0.46
250 0.39
251 0.33
252 0.25
253 0.23
254 0.15
255 0.12
256 0.08
257 0.07
258 0.07
259 0.08
260 0.09
261 0.12
262 0.15
263 0.2
264 0.23
265 0.27
266 0.29
267 0.35
268 0.44
269 0.49
270 0.56
271 0.56
272 0.55
273 0.54
274 0.55
275 0.51
276 0.43
277 0.35
278 0.25
279 0.2
280 0.19
281 0.2