Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NQX9

Protein Details
Accession A0A2R6NQX9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
310-329STIVFKKVKTESKLPKPKRKHydrophilic
NLS Segment(s)
PositionSequence
288-329RRKFRALQAPEPVKPVARKEPASTIVFKKVKTESKLPKPKRK
Subcellular Location(s) mito 15, cyto 5.5, cyto_nucl 4.5, nucl 2.5, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001708  YidC/ALB3/OXA1/COX18  
IPR028055  YidC/Oxa/ALB_C  
Gene Ontology GO:0031090  C:organelle membrane  
GO:0032977  F:membrane insertase activity  
Pfam View protein in Pfam  
PF02096  60KD_IMP  
Amino Acid Sequences MLAQRAARHVFRPPALRPRFAHKELNRPRTFVTEAIQSLSNEFLDLALAIPYPQSIPPYSGTIILVTVAKKRQWRAEELALPQLQQEKPEILQRVHQDMHKDGFRGNKEEAAMEHSKRAEPLLTTRRNELFKKYKCSPTATMLIGPLTQLPIFVSTSLMLSHASQPPTVFDSESFFTLSSLAHSDPTLTLPIVLGILTLANVESSRWFISAAALEREQKVAEWNTKKRAMGHTVIEPKKIVQSTLRVLAVARILIAALVPGSIQLYWVTSAVFGLVQTWIIDWVDHRRRKFRALQAPEPVKPVARKEPASTIVFKKVKTESKLPKPKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.64
4 0.59
5 0.61
6 0.65
7 0.63
8 0.67
9 0.62
10 0.67
11 0.71
12 0.79
13 0.72
14 0.65
15 0.62
16 0.57
17 0.54
18 0.45
19 0.38
20 0.34
21 0.32
22 0.32
23 0.32
24 0.26
25 0.24
26 0.23
27 0.2
28 0.13
29 0.12
30 0.1
31 0.07
32 0.07
33 0.06
34 0.05
35 0.06
36 0.05
37 0.05
38 0.06
39 0.07
40 0.08
41 0.1
42 0.1
43 0.13
44 0.15
45 0.19
46 0.19
47 0.19
48 0.19
49 0.16
50 0.15
51 0.14
52 0.14
53 0.11
54 0.15
55 0.17
56 0.2
57 0.26
58 0.3
59 0.37
60 0.39
61 0.44
62 0.47
63 0.52
64 0.53
65 0.51
66 0.54
67 0.46
68 0.42
69 0.36
70 0.35
71 0.27
72 0.23
73 0.22
74 0.17
75 0.18
76 0.24
77 0.26
78 0.21
79 0.26
80 0.29
81 0.32
82 0.33
83 0.33
84 0.31
85 0.3
86 0.34
87 0.31
88 0.28
89 0.24
90 0.29
91 0.3
92 0.31
93 0.29
94 0.26
95 0.25
96 0.25
97 0.23
98 0.23
99 0.24
100 0.2
101 0.22
102 0.21
103 0.21
104 0.2
105 0.2
106 0.15
107 0.13
108 0.2
109 0.27
110 0.32
111 0.33
112 0.37
113 0.41
114 0.44
115 0.45
116 0.45
117 0.45
118 0.45
119 0.51
120 0.53
121 0.56
122 0.55
123 0.59
124 0.53
125 0.47
126 0.46
127 0.39
128 0.34
129 0.27
130 0.24
131 0.19
132 0.16
133 0.11
134 0.07
135 0.06
136 0.05
137 0.05
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.07
146 0.06
147 0.06
148 0.1
149 0.12
150 0.13
151 0.13
152 0.13
153 0.13
154 0.14
155 0.14
156 0.11
157 0.08
158 0.11
159 0.11
160 0.12
161 0.11
162 0.09
163 0.09
164 0.09
165 0.09
166 0.07
167 0.08
168 0.07
169 0.07
170 0.07
171 0.08
172 0.08
173 0.09
174 0.09
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.05
181 0.04
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.08
197 0.11
198 0.13
199 0.13
200 0.14
201 0.16
202 0.16
203 0.17
204 0.15
205 0.13
206 0.15
207 0.16
208 0.24
209 0.3
210 0.35
211 0.42
212 0.46
213 0.47
214 0.46
215 0.49
216 0.46
217 0.42
218 0.4
219 0.41
220 0.47
221 0.47
222 0.45
223 0.39
224 0.34
225 0.35
226 0.32
227 0.26
228 0.2
229 0.23
230 0.26
231 0.3
232 0.29
233 0.24
234 0.24
235 0.24
236 0.21
237 0.16
238 0.12
239 0.07
240 0.07
241 0.06
242 0.06
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.04
249 0.04
250 0.05
251 0.05
252 0.06
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.07
259 0.07
260 0.05
261 0.05
262 0.05
263 0.06
264 0.06
265 0.06
266 0.07
267 0.07
268 0.07
269 0.09
270 0.19
271 0.28
272 0.35
273 0.4
274 0.47
275 0.51
276 0.58
277 0.66
278 0.66
279 0.67
280 0.7
281 0.74
282 0.76
283 0.79
284 0.73
285 0.67
286 0.58
287 0.52
288 0.47
289 0.45
290 0.45
291 0.45
292 0.46
293 0.47
294 0.53
295 0.54
296 0.55
297 0.54
298 0.49
299 0.51
300 0.51
301 0.47
302 0.46
303 0.48
304 0.53
305 0.54
306 0.59
307 0.6
308 0.68
309 0.79