Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6S5C1

Protein Details
Accession A0A2R6S5C1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-31ASRVQCGGIRKLRRRRLWRGRREGRGEVRBasic
NLS Segment(s)
PositionSequence
12-49RKLRRRRLWRGRREGRGEVRMRKAAGRREDSEKSERKR
Subcellular Location(s) mito 11.5, cyto_mito 9.5, nucl 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGASRVQCGGIRKLRRRRLWRGRREGRGEVRMRKAAGRREDSEKSERKRIRCRVEDDPTEQKAHFPYDQSALAFLRVWRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.83
4 0.85
5 0.88
6 0.89
7 0.9
8 0.9
9 0.9
10 0.89
11 0.86
12 0.84
13 0.79
14 0.78
15 0.73
16 0.69
17 0.65
18 0.58
19 0.52
20 0.48
21 0.46
22 0.44
23 0.45
24 0.43
25 0.4
26 0.44
27 0.46
28 0.46
29 0.48
30 0.49
31 0.46
32 0.5
33 0.52
34 0.53
35 0.6
36 0.65
37 0.67
38 0.67
39 0.69
40 0.68
41 0.72
42 0.7
43 0.66
44 0.64
45 0.57
46 0.52
47 0.46
48 0.39
49 0.33
50 0.32
51 0.28
52 0.22
53 0.23
54 0.24
55 0.26
56 0.24
57 0.25
58 0.21
59 0.2
60 0.19
61 0.19