Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6S748

Protein Details
Accession A0A2R6S748    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
249-277DEFRDSWNKHKIRRQPKKRMPSGNTPSMFHydrophilic
NLS Segment(s)
PositionSequence
257-267KHKIRRQPKKR
Subcellular Location(s) nucl 13.5, cyto_nucl 11.833, cyto 9, cyto_pero 6.333
Family & Domain DBs
Amino Acid Sequences MPGNPLLKTKTDNMSGSNPDGNNGVDNGIFTQLVHYRLEEDNSSGSEATLYKLQKHFNTPSARRTSKMPAELVDQLVLNKMSDINDHDQKWGVGRTMDVLAKDNTPVPRSIVRQVKQQNEPLAVDARFPGRKKIPRGHLKCIGPFYEVNCDGHEKLGSLALKMGPVELPIYGMKDKWSSAILHLVVVPNDRLETTIGHVYLDFVESFGAIPIQITVDKGSETGYMRQFQLELRKLFNWLWPPIIQYELDEFRDSWNKHKIRRQPKKRMPSGNTPSMFFRCPELFKGIRSGAQARKEDVNALRTRIPVSREDAFRWVDSNFAMVVGAIYEGNNSVEILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.44
4 0.44
5 0.38
6 0.33
7 0.33
8 0.29
9 0.24
10 0.2
11 0.17
12 0.11
13 0.12
14 0.12
15 0.12
16 0.11
17 0.09
18 0.12
19 0.15
20 0.17
21 0.17
22 0.16
23 0.18
24 0.2
25 0.23
26 0.21
27 0.19
28 0.19
29 0.19
30 0.21
31 0.17
32 0.15
33 0.14
34 0.13
35 0.13
36 0.16
37 0.17
38 0.21
39 0.25
40 0.31
41 0.33
42 0.41
43 0.44
44 0.46
45 0.55
46 0.54
47 0.59
48 0.63
49 0.62
50 0.55
51 0.55
52 0.57
53 0.54
54 0.54
55 0.47
56 0.39
57 0.41
58 0.42
59 0.38
60 0.3
61 0.23
62 0.18
63 0.18
64 0.16
65 0.12
66 0.09
67 0.09
68 0.09
69 0.1
70 0.15
71 0.19
72 0.24
73 0.25
74 0.26
75 0.26
76 0.26
77 0.27
78 0.24
79 0.19
80 0.14
81 0.13
82 0.14
83 0.16
84 0.17
85 0.15
86 0.16
87 0.16
88 0.16
89 0.17
90 0.18
91 0.17
92 0.18
93 0.18
94 0.18
95 0.22
96 0.24
97 0.31
98 0.37
99 0.36
100 0.43
101 0.5
102 0.54
103 0.55
104 0.57
105 0.52
106 0.46
107 0.44
108 0.37
109 0.34
110 0.26
111 0.22
112 0.18
113 0.18
114 0.2
115 0.2
116 0.24
117 0.28
118 0.35
119 0.42
120 0.49
121 0.55
122 0.62
123 0.68
124 0.7
125 0.7
126 0.66
127 0.63
128 0.57
129 0.48
130 0.39
131 0.34
132 0.27
133 0.26
134 0.24
135 0.21
136 0.19
137 0.2
138 0.18
139 0.18
140 0.16
141 0.1
142 0.09
143 0.12
144 0.11
145 0.09
146 0.1
147 0.09
148 0.09
149 0.09
150 0.09
151 0.05
152 0.06
153 0.06
154 0.05
155 0.06
156 0.06
157 0.07
158 0.07
159 0.08
160 0.09
161 0.09
162 0.09
163 0.09
164 0.1
165 0.09
166 0.1
167 0.14
168 0.13
169 0.12
170 0.13
171 0.13
172 0.11
173 0.12
174 0.11
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.07
181 0.08
182 0.1
183 0.1
184 0.1
185 0.1
186 0.1
187 0.09
188 0.1
189 0.07
190 0.05
191 0.05
192 0.05
193 0.05
194 0.04
195 0.04
196 0.03
197 0.03
198 0.03
199 0.04
200 0.04
201 0.05
202 0.06
203 0.06
204 0.06
205 0.06
206 0.07
207 0.09
208 0.11
209 0.15
210 0.18
211 0.19
212 0.19
213 0.2
214 0.19
215 0.19
216 0.27
217 0.28
218 0.27
219 0.28
220 0.29
221 0.31
222 0.31
223 0.33
224 0.3
225 0.25
226 0.26
227 0.23
228 0.24
229 0.22
230 0.23
231 0.19
232 0.15
233 0.18
234 0.18
235 0.19
236 0.19
237 0.18
238 0.2
239 0.28
240 0.28
241 0.29
242 0.37
243 0.4
244 0.46
245 0.55
246 0.61
247 0.65
248 0.75
249 0.8
250 0.82
251 0.87
252 0.91
253 0.92
254 0.93
255 0.88
256 0.88
257 0.85
258 0.83
259 0.74
260 0.65
261 0.59
262 0.52
263 0.47
264 0.36
265 0.33
266 0.27
267 0.28
268 0.29
269 0.32
270 0.3
271 0.3
272 0.36
273 0.33
274 0.32
275 0.33
276 0.37
277 0.37
278 0.43
279 0.44
280 0.41
281 0.44
282 0.42
283 0.44
284 0.41
285 0.43
286 0.38
287 0.39
288 0.39
289 0.36
290 0.38
291 0.36
292 0.35
293 0.3
294 0.33
295 0.37
296 0.37
297 0.39
298 0.41
299 0.4
300 0.38
301 0.36
302 0.3
303 0.25
304 0.21
305 0.2
306 0.14
307 0.11
308 0.1
309 0.08
310 0.08
311 0.06
312 0.07
313 0.05
314 0.05
315 0.06
316 0.07
317 0.08
318 0.08