Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NM50

Protein Details
Accession A0A2R6NM50    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-61FWDRWNRGKQWKDLRQKHVQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, golg 5, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MSVSTIFYNTIVKRNSVFVTSIFAGAFAFGVGFDIGVTAFWDRWNRGKQWKDLRQKHVQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.24
4 0.23
5 0.16
6 0.2
7 0.19
8 0.18
9 0.14
10 0.13
11 0.11
12 0.1
13 0.09
14 0.04
15 0.03
16 0.02
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.07
28 0.1
29 0.12
30 0.19
31 0.24
32 0.29
33 0.38
34 0.45
35 0.52
36 0.61
37 0.69
38 0.73
39 0.78
40 0.81
41 0.82