Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6S717

Protein Details
Accession A0A2R6S717    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32LQVLKEQRKRTTRSLKQGHQSLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 9.832, cyto 9, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MDYQVKLKVLQVLKEQRKRTTRSLKQGHQSLQTPRTLVQKQLRALNIDCETQLCRTHFCHLPPVSPKSKGLTVQVIQLENVEGVHEFYISSMLESKDQVKPGSLYTFKGSGDKSKKLGGGDFQVGGGVGLTKPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.66
4 0.71
5 0.73
6 0.74
7 0.74
8 0.73
9 0.76
10 0.8
11 0.79
12 0.8
13 0.81
14 0.75
15 0.7
16 0.66
17 0.62
18 0.57
19 0.51
20 0.43
21 0.38
22 0.41
23 0.37
24 0.39
25 0.39
26 0.41
27 0.42
28 0.46
29 0.46
30 0.41
31 0.4
32 0.39
33 0.33
34 0.27
35 0.24
36 0.19
37 0.19
38 0.17
39 0.2
40 0.15
41 0.15
42 0.16
43 0.21
44 0.23
45 0.23
46 0.3
47 0.27
48 0.31
49 0.33
50 0.37
51 0.36
52 0.34
53 0.34
54 0.28
55 0.3
56 0.27
57 0.24
58 0.24
59 0.21
60 0.23
61 0.24
62 0.22
63 0.19
64 0.18
65 0.15
66 0.1
67 0.1
68 0.06
69 0.04
70 0.04
71 0.05
72 0.04
73 0.04
74 0.04
75 0.06
76 0.05
77 0.06
78 0.07
79 0.08
80 0.09
81 0.1
82 0.14
83 0.16
84 0.18
85 0.18
86 0.18
87 0.18
88 0.2
89 0.26
90 0.24
91 0.23
92 0.24
93 0.25
94 0.24
95 0.27
96 0.26
97 0.29
98 0.34
99 0.37
100 0.37
101 0.39
102 0.41
103 0.39
104 0.41
105 0.36
106 0.34
107 0.33
108 0.3
109 0.26
110 0.23
111 0.21
112 0.18
113 0.14
114 0.09