Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6P2B5

Protein Details
Accession A0A2R6P2B5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-113RTAPPQPQQLPSKKKKPRRTGKENKKPKELSGBasic
NLS Segment(s)
PositionSequence
81-110KRTAPPQPQQLPSKKKKPRRTGKENKKPKE
Subcellular Location(s) cyto_nucl 11.666, nucl 11, cyto 10, cyto_mito 9.166, mito 6
Family & Domain DBs
Amino Acid Sequences MFSSNSPVRPDKVSFDDMTTVSMGVKAVRDIPAGSCILSLCGSMSSDTVEGNITVSGYGGYGGGLCVCATCNPTNPPVAKKRTAPPQPQQLPSKKKKPRRTGKENKKPKELSGGDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.35
4 0.31
5 0.3
6 0.24
7 0.18
8 0.13
9 0.13
10 0.1
11 0.08
12 0.08
13 0.08
14 0.09
15 0.1
16 0.11
17 0.11
18 0.12
19 0.14
20 0.13
21 0.13
22 0.11
23 0.1
24 0.1
25 0.1
26 0.09
27 0.06
28 0.06
29 0.07
30 0.06
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.07
57 0.08
58 0.12
59 0.13
60 0.15
61 0.2
62 0.21
63 0.27
64 0.32
65 0.37
66 0.38
67 0.41
68 0.46
69 0.52
70 0.6
71 0.62
72 0.62
73 0.67
74 0.7
75 0.72
76 0.74
77 0.74
78 0.75
79 0.76
80 0.78
81 0.77
82 0.81
83 0.85
84 0.88
85 0.89
86 0.9
87 0.92
88 0.93
89 0.94
90 0.95
91 0.95
92 0.92
93 0.91
94 0.84
95 0.76
96 0.75