Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6S5L2

Protein Details
Accession A0A2R6S5L2    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-72LEQTVAPKKKRKRGKSRKPSTITDGHydrophilic
104-130RSKTTNTKADKGKKKLKEKSRGALSTCHydrophilic
NLS Segment(s)
PositionSequence
54-66PKKKRKRGKSRKP
111-124KADKGKKKLKEKSR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MTRYTNVALKKRPYVEAGFNYREEPEMPEASTSNTAPQNTAEAGSSTLEQTVAPKKKRKRGKSRKPSTITDGGAEGTETTAAAEDRGGGAVQPSDGTVGNSPVRSKTTNTKADKGKKKLKEKSRGALSTCKLHDWDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.51
4 0.53
5 0.48
6 0.46
7 0.44
8 0.4
9 0.36
10 0.28
11 0.24
12 0.21
13 0.19
14 0.19
15 0.18
16 0.18
17 0.19
18 0.21
19 0.17
20 0.17
21 0.19
22 0.19
23 0.18
24 0.18
25 0.18
26 0.16
27 0.16
28 0.12
29 0.1
30 0.1
31 0.1
32 0.1
33 0.08
34 0.08
35 0.07
36 0.07
37 0.09
38 0.17
39 0.23
40 0.28
41 0.36
42 0.44
43 0.53
44 0.63
45 0.71
46 0.74
47 0.78
48 0.85
49 0.88
50 0.91
51 0.92
52 0.88
53 0.8
54 0.75
55 0.69
56 0.58
57 0.47
58 0.37
59 0.27
60 0.21
61 0.18
62 0.11
63 0.05
64 0.05
65 0.04
66 0.03
67 0.03
68 0.03
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.07
84 0.07
85 0.1
86 0.12
87 0.13
88 0.14
89 0.15
90 0.18
91 0.19
92 0.22
93 0.29
94 0.36
95 0.45
96 0.5
97 0.55
98 0.62
99 0.7
100 0.77
101 0.77
102 0.78
103 0.78
104 0.83
105 0.86
106 0.87
107 0.87
108 0.86
109 0.86
110 0.86
111 0.83
112 0.76
113 0.75
114 0.69
115 0.67
116 0.6
117 0.53