Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NL00

Protein Details
Accession A0A2R6NL00    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRTKKTRAIRRRLTKHEESLKTLKQRKKDIHFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
75-114KKKKYAPLDLRTKKTRAIRRRLTKHEESLKTLKQRKKDIH
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLTKQLTELKTELLTLRVQKIAGGSAAKLTRISTVRKSIARVMTVMNQKARQNLRELYKKKKYAPLDLRTKKTRAIRRRLTKHEESLKTLKQRKKDIHFPIRKYAVKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.54
5 0.5
6 0.49
7 0.48
8 0.53
9 0.48
10 0.44
11 0.42
12 0.35
13 0.29
14 0.25
15 0.22
16 0.15
17 0.16
18 0.16
19 0.18
20 0.17
21 0.16
22 0.16
23 0.16
24 0.15
25 0.14
26 0.12
27 0.09
28 0.12
29 0.13
30 0.13
31 0.12
32 0.12
33 0.14
34 0.16
35 0.2
36 0.2
37 0.25
38 0.29
39 0.3
40 0.32
41 0.33
42 0.33
43 0.3
44 0.27
45 0.23
46 0.25
47 0.27
48 0.27
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.26
55 0.27
56 0.29
57 0.34
58 0.41
59 0.44
60 0.47
61 0.54
62 0.58
63 0.58
64 0.61
65 0.59
66 0.6
67 0.65
68 0.65
69 0.67
70 0.69
71 0.72
72 0.69
73 0.67
74 0.63
75 0.62
76 0.63
77 0.62
78 0.65
79 0.69
80 0.74
81 0.82
82 0.85
83 0.85
84 0.82
85 0.81
86 0.81
87 0.74
88 0.7
89 0.68
90 0.66
91 0.67
92 0.69
93 0.65
94 0.63
95 0.69
96 0.72
97 0.73
98 0.76
99 0.77
100 0.8
101 0.84
102 0.81
103 0.81
104 0.81
105 0.77